KEGG   Pseudoalteromonas haloplanktis: PSHAa2301Help
Entry
PSHAa2301         CDS       T00282                                 

Definition
phosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSHAa2301
Enzymes [BR:pha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PSHAa2301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2445866..2446303)
Genome map
AA seq 145 aa AA seqDB search
MRCALIALKPHFNDLVHSSVFESEAVGFAGNNFYNSVVGATTDMPLADVCSLLKQIERNN
GRTANDKKFSPRTLDLDLLFYDDVICDSPAQLPRDEITKNAFVLQPLAEVAPHFYHPVAQ
QTIADLWREYNNPQQKLWKVEFSNP
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgtgcgcttatagcgctcaagccgcactttaacgacttagtgcattcctcagta
tttgaaagcgaagcggttggatttgctggtaataacttttataactcggtggttggtgct
acaaccgatatgccattagcagatgtatgtagcttactaaagcaaattgagcgcaataat
ggccgtactgcaaacgataaaaagtttagcccgcggactctcgatttagatttactattt
tatgatgatgtaatttgcgactctcccgcacaattaccacgtgacgaaattacaaaaaac
gcctttgtattacagcccctagctgaagtggccccgcatttttatcaccctgttgcacag
caaaccattgccgatctttggcgcgagtacaacaaccctcaacaaaaactatggaaggtg
gagttttctaacccatga

DBGET integrated database retrieval system