KEGG   Pseudoalteromonas haloplanktis: PSHAa2380Help
Entry
PSHAa2380         CDS       T00282                                 

Definition
(GenBank) putative response regulator with Chemotaxis-specific methylesterase domain (EC:3.1.1.61)
Organism
pha  Pseudoalteromonas haloplanktis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:complement(2528608..2528976)
Genome map
AA seq 122 aa AA seqDB search
MMNFSILVCDDSAVARKQVIRCLNDCITADIRQAINGVDALALLKEQHFDLVCLDLTMPI
LDGVQVLEHIKAEKMECFVLVISADIQQQMQQRVAQLGVIGFIEKPVSKIILNNILHKFG
IY
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacttttctattttagtttgtgacgattcagcagtagcccgcaaacaagtgata
cgttgcttaaatgactgtataaccgccgatatacgccaagcgataaatggagtagatgcg
ttagcgttattgaaagaacaacattttgatttagtttgcctcgatttaactatgccgata
ctcgatggtgtgcaggtgttggagcatattaaagcagaaaaaatggagtgttttgtatta
gtcatttcggcagatattcaacagcaaatgcagcagcgcgtagcacaattaggtgttata
gggtttatcgaaaagccagttagcaaaataatacttaataatattttgcataaatttggc
atttactag

DBGET integrated database retrieval system