KEGG   Pseudoalteromonas haloplanktis: PSHAa2380Help
Entry
PSHAa2380         CDS       T00282                                 

Definition
response regulator (EC:3.1.1.61)
Orthology
K05971  
[EC:3.1.1.61]
Organism
pha  Pseudoalteromonas haloplanktis
Brite
Enzymes [BR:pha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PSHAa2380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2528608..2528976)
Genome map
AA seq 122 aa AA seqDB search
MMNFSILVCDDSAVARKQVIRCLNDCITADIRQAINGVDALALLKEQHFDLVCLDLTMPI
LDGVQVLEHIKAEKMECFVLVISADIQQQMQQRVAQLGVIGFIEKPVSKIILNNILHKFG
IY
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacttttctattttagtttgtgacgattcagcagtagcccgcaaacaagtgata
cgttgcttaaatgactgtataaccgccgatatacgccaagcgataaatggagtagatgcg
ttagcgttattgaaagaacaacattttgatttagtttgcctcgatttaactatgccgata
ctcgatggtgtgcaggtgttggagcatattaaagcagaaaaaatggagtgttttgtatta
gtcatttcggcagatattcaacagcaaatgcagcagcgcgtagcacaattaggtgttata
gggtttatcgaaaagccagttagcaaaataatacttaataatattttgcataaatttggc
atttactag

DBGET integrated database retrieval system