KEGG   Pseudoalteromonas haloplanktis: PSHAa2424Help
Entry
PSHAa2424         CDS       T00282                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PSHAa2424 (holC)
   00240 Pyrimidine metabolism
    PSHAa2424 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PSHAa2424 (holC)
   03430 Mismatch repair
    PSHAa2424 (holC)
   03440 Homologous recombination
    PSHAa2424 (holC)
Enzymes [BR:pha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PSHAa2424 (holC)
DNA replication proteins [BR:pha03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PSHAa2424 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2574827..2575273
Genome map
AA seq 148 aa AA seqDB search
MNMNAQFFVLKQQDESLAKPDDHLALAAQIAADQYRLGQRVFICVDNENTAFAIDETLWA
FDPDSFVPHNLQGEGPKGGAPVEIGTTPPVGNRKVLINLANNLPDFIRRFNQVFDFVPVE
AVAKQAARERFKKLRQLGANITTQDINN
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgaacgcccaatttttcgttctaaagcaacaagatgagtcgctggctaagcct
gatgatcatttggctttggcggctcaaattgccgctgatcagtatcggcttggccaacgt
gtatttatttgtgtagataacgaaaataccgcctttgccattgatgaaacactttgggca
tttgatcccgacagttttgtacctcataacctacaaggtgaaggcccaaaaggcggcgca
ccggtagaaattggtactacgccccctgttggcaatcgtaaagttttaattaacttggct
aataacttaccggattttattcgccgctttaaccaagtttttgattttgtacccgtagaa
gccgttgctaaacaagcagctcgcgagcgttttaaaaagctacgccaactcggtgctaac
atcaccacgcaagatattaataactaa

DBGET integrated database retrieval system