KEGG   Pseudoalteromonas haloplanktis: PSHAa2897Help
Entry
PSHAa2897         CDS       T00282                                 

Definition
long chain acyl-CoA desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pha01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pha01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3066120..3067253
Genome map
AA seq 377 aa AA seqDB search
MNKPPLIWTNVLFFSLTFLAAITLVPWYGINYGFSSAHWIAFVGCMFYAGLSITAGYHRL
WAHKTYNAHPAVEFVFALGGAFALQNSALHWSSDHRVHHGQVDDPIKDPYAATNGFWYSH
IGWMLRDYQADSYGDYSNCRDLQRNKIVMWQHKHYLKLALLMNVGLPLTLGLLVGDVWGM
LLLAGLLRLVLSQHFTFFINSVAHIWGSRPYTEKNTARDNGFLALFTYGEGYHNFHHIFA
SDYRNGIRWFHYDPTKWVIRSLAALGLASKLKRTPVERIEKAKAETLMSKTQVRLAKLPL
AQDKLTLLQQEYDLLLKKLQNYCSLQKQVLEVKKNNMAKQCERSALMAQYHELEAAWENQ
KQAWLALNARLLKASFS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaccaccacttatttggaccaacgtcctattttttagccttacttttttggcc
gcgataacgcttgtgccttggtatggtattaactacggattttctagtgcccactggatt
gcctttgtcggctgtatgttttatgcaggcttatcaattactgccggttaccacagattg
tgggcacataaaacctataacgcccatccggcggttgagtttgtgtttgccttaggcggt
gcatttgcactgcaaaacagtgcactacattggagcagcgaccaccgtgtgcatcacggc
caagttgacgacccaataaaagacccttatgccgcaaccaatggtttttggtatagccat
attggctggatgttacgtgactatcaagctgatagctacggcgattacagtaactgtcgc
gatttacaacgcaataaaattgtaatgtggcaacacaaacattatttaaagttagctctt
ttaatgaatgtaggcctacctcttacgctaggattactagttggcgatgtatggggcatg
ttattacttgccggtttactgcgcttagtacttagtcagcactttaccttttttattaat
tcggtagcccatatttggggctctcgtccgtacaccgaaaaaaataccgcccgcgacaac
ggctttttagccctatttacatatggcgaggggtatcataactttcatcatatttttgcc
agtgattaccgtaacggcattaggtggtttcattatgaccccactaaatgggttattcgc
tcgttagctgcccttggtttagccagtaaactaaagcgcacaccggttgaacgcattgaa
aaagccaaggccgaaactttaatgagcaaaacacaagttcgtcttgcaaaattgccttta
gcacaagataagcttacattattacaacaagaatatgatttactgctgaaaaaactgcaa
aattattgttcactacaaaaacaagtgttagaagttaaaaaaaataacatggcaaagcag
tgtgaacgttcagcattaatggcacaataccatgagctggaagccgcctgggaaaaccaa
aagcaggcatggctagcacttaatgcgaggttattaaaagcctcttttagttaa

DBGET integrated database retrieval system