KEGG   Pseudoalteromonas haloplanktis: PSHAa2944Help
Entry
PSHAa2944         CDS       T00282                                 

Gene name
bdhA
Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pha00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:pha00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3118983..3119744)
Genome map
AA seq 253 aa AA seqDB search
MSKTILITGAASGIGLYIAQQLAAAGHHIIVTDLNAAHAKEAAEDIVTNGGKAQGYALNV
ADSEAITVFFKQLPQAVDVLINNAGIQHVAKLEEFPADKWQFLQQVMLVGPAMMTQAVLP
KMREQNFGRIINIGSIHAMVASKYKSAYVAAKHGLIGFSKTIALETGDANITINTVCPAY
VKTPLVEQQIAAQAKEHGLSEQQVIDTIMLAPMPKKAFIGLDEIHHTVTFLMADAARNIT
AQAIAIDGGWTAQ
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaacaattttaataaccggtgcagccagcggtattggcttatatatagcacag
caattagccgcagcgggtcatcatattatagtaaccgacctaaatgcagcgcacgcaaaa
gaagcggcagaagatattgttactaatggcggaaaagcccaaggttatgcattaaatgtg
gccgacagcgaggcaattaccgttttttttaagcagttaccgcaagctgttgatgtactt
ataaataatgccggcattcagcacgtagcaaagcttgaagaatttccggctgataaatgg
caatttttgcagcaagtaatgctcgttgggcctgcaatgatgacccaagcggtattgcct
aaaatgcgggaacaaaattttggccgaattattaatattggctctattcatgccatggtg
gcctctaaatataagtcggcctatgtggccgccaaacatggcttaattggctttagtaaa
accatagcgcttgaaacaggagatgccaatataaccattaataccgtgtgccccgcgtat
gtgaaaactccgctagtagagcagcaaattgccgcacaagccaaagagcatggtttatct
gagcaacaagttatcgatactattatgctagcacccatgcctaaaaaagcctttattggt
ttagatgaaatacaccatacggtaacctttttaatggctgatgcggcgcgaaacattacc
gcacaagctatagcaatagatggcggctggaccgcacaatag

DBGET integrated database retrieval system