KEGG   Pseudoalteromonas haloplanktis: PSHAb0062Help
Entry
PSHAb0062         CDS       T00282                                 

Gene name
aceA
Definition
(GenBank) Isocitrate lyase 2
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
pha00630  Glyoxylate and dicarboxylate metabolism
pha01100  Metabolic pathways
pha01110  Biosynthesis of secondary metabolites
pha01120  Microbial metabolism in diverse environments
pha01200  Carbon metabolism
Module
pha_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PSHAb0062 (aceA)
Enzymes [BR:pha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PSHAb0062 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase Myb_DNA-bind_6
Motif
Other DBs
NCBI-ProteinID: CAI89112
UniProt: Q3ICR8
Position
II:71232..72833
Genome map
AA seq 533 aa AA seqDB search
MTTYKSETDTLATLCKKQGSAWKTINPEYATRMRLQNRFRTGVEIAQFTADIMREDMAAY
DADTSQYTQSLGCWHGFTAQQMMMAIKRHQKTTKRSYVYLSGWMVAALRSEFGPLPDQSM
HEKTSVPALIEEIYTFLKQADARELDHLFNDLDAAKANGGDVQAVLDKIDNFETHVVPII
ADIDAGFGNEEATYLLAKKMIEAGACAIQIENQVSDAKQCGHQAGKVTVPHEDFLAKINA
VRYAFLELGIDNGIIVARTDSLGASLTQKVPVSQTPGDLASQYNAFLETTPINGVEDLNE
GDTAMKLNGQLCKPTRLDNGLFQFREGTEKDRVVLDCVTSLQSGADLLWIETEKPHVKQI
AELVNRVKEQVPDAKLVYNNSPSFNWTLKFREQVYQEWQEAGRDLSAYPSLGDNKGLMAP
EMDATELAVAADLLVQNFQRDGAREAGIFHHLITLPTYHTAALSTDILSEGYFGDLGMLA
YVRDVQRQEIRREQASVKHQDLAGSNIGDTHKEYFSGDNALKAGGEDNTMNQF
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactacatataaaagcgaaacagatacattagcaacactttgtaaaaaacaaggtagt
gcatggaaaaccattaaccctgaatatgcaacacgtatgcgtttacaaaatcgctttcgt
actggggtagaaattgcacagtttactgctgacattatgcgtgaagacatggccgcatac
gacgcagatacaagccagtacactcagtctttaggttgttggcatggatttactgcgcaa
caaatgatgatggctattaagcgccatcaaaaaacaactaagcgtagttatgtatactta
agtggctggatggttgcggcacttcgttcagagtttggtccgcttccggatcaaagtatg
cacgaaaaaacctcagttccggcactaattgaagaaatttacacctttttaaagcaagcc
gatgcacgtgaactagaccatttatttaatgacctagatgcagctaaagcaaatggcggc
gacgtacaagcggtactagataaaattgataactttgaaacgcacgtagtgccaattatt
gctgatattgatgccggttttggtaacgaagaagcaacttacctactcgctaaaaaaatg
attgaagcaggtgcttgtgcaattcaaatcgaaaaccaagtgtctgacgctaagcaatgt
ggccaccaagcaggtaaagtaaccgtaccgcacgaagactttttagctaaaattaacgca
gtacgttacgcatttttagaactgggcattgataacggtattattgttgcgcgtaccgat
tcactaggcgccagcctaacgcaaaaagtaccggtttcacaaactccaggtgacttagct
agccagtacaatgcatttttagaaactacgccaattaacggtgttgaagatttaaatgaa
ggcgacactgcaatgaagcttaatggccaactttgcaaaccaacgcgccttgataatggt
ttattccagttccgcgaaggtacagaaaaagaccgcgtagtactagattgtgtaactagc
ctacagtcgggtgcagatttactgtggattgaaaccgaaaaaccacatgttaagcaaatt
gctgagctggttaatcgtgttaaagagcaagtgccagatgctaagcttgtttataacaac
tcaccgtcgtttaactggacacttaagtttcgtgagcaagtgtatcaagaatggcaagaa
gcgggccgtgaccttagcgcttacccaagcttgggtgacaataaaggccttatggcacca
gaaatggatgctaccgagcttgcagtagcagccgatttactagtacaaaacttccaacgt
gatggtgcacgtgaagccggtattttccatcacctaatcacattgccaacgtaccataca
gcagcactaagtacggatattttgtcagaaggttactttggtgacttaggtatgctggct
tatgtacgtgatgtacagcgtcaagagattcgtcgcgaacaagcgtctgttaagcaccaa
gaccttgcaggctctaacattggcgatacacacaaagagtacttctctggtgataatgcg
cttaaagccggtggtgaagataacaccatgaaccaattctaa

DBGET integrated database retrieval system