KEGG   Pseudoalteromonas haloplanktis: PSHAb0317Help
Entry
PSHAb0317         CDS       T00282                                 

Definition
manganese binding agmatinase (SpeB) (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PSHAb0317
Enzymes [BR:pha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PSHAb0317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:367765..368874
Genome map
AA seq 369 aa AA seqDB search
MSTEFQEFKSKIEHCLCAPGDGVYTVNTAKERKAVLRNKLYGQTENIGPLWRESLNELPN
SPHKAVMLGISSDCGGGILRGANWGPLFLRSALLDQQPQCRSFDLGDVRVIPHLLHDKYL
NKATITNCQKALYGNENNDYYVSPLSITEDVCDSFYATFENKGIFGIGGDHSISYPLTKA
YLKAKRAQGKRTAIIHFDAHTDLLVERLGIDLCFGSWCTHILEFLPAPHHLIQFGIRSSG
KPKEHWESTFGVKQHWAHEIIERGAAAVAADAIAQLKADNVDEVYVSFDIDALDEKFASA
TGTPEANGLTPQHALDILSAIADEFPITGADMMEIAPFTDSSLVGQSSSETTLREGAKIS
AFLISAMNK
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgaatttcaggaatttaaaagcaaaattgagcattgtttgtgcgcaccaggt
gatggtgtatatacagttaacactgcaaaagagcgcaaagctgtattaagaaataagctt
tatgggcaaaccgaaaacattggcccattatggcgtgagtcgcttaacgagttacccaat
tcgccgcataaagcggtaatgctaggtattagctcagattgtggcggcggtattttacgt
ggcgcaaactgggggccgttatttttacgctcagcattacttgatcagcaacctcagtgc
cgctcattcgatttaggcgacgtacgcgttattcctcatttattacatgataaatactta
aacaaagccactataaccaattgccaaaaagcattatacggcaacgaaaataacgactat
tacgttagcccactgtcgatcactgaagatgtgtgcgacagcttttatgcaacatttgaa
aataaaggcatttttggtattggcggcgatcattcaattagttacccattaacaaaagcg
tatttaaaagctaagcgcgcacaaggcaagcgtaccgcaattattcattttgatgcccat
accgacttattggttgagcgcttaggcattgatttatgttttggctcttggtgtacgcat
attttagagtttttacctgcgccacatcatttaattcaatttggtattcgttcaagcggt
aaaccgaaagagcattgggaaagcacctttggtgttaaacaacattgggcgcatgaaatt
atagagcgcggtgcagcagccgttgccgcagatgccattgcccagcttaaagccgacaac
gttgacgaagtgtatgttagctttgatattgacgcccttgatgaaaaatttgcctctgca
acaggcacaccagaggcaaacggcttaacgccacagcacgcactggatattttatcagcc
atagccgatgaatttccgatcaccggtgccgatatgatggaaattgcgccttttaccgac
agctcgctagtagggcagtcaagttcagaaaccactttacgcgagggcgctaaaatttcg
gcgtttttaattagtgcgatgaacaagtaa

DBGET integrated database retrieval system