KEGG   Pseudoalteromonas haloplanktis: PSHAb0511Help
Entry
PSHAb0511         CDS       T00282                                 

Gene name
adhP
Definition
(GenBank) alcohol dehydrogenase, propanol-preferring
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
pha00010  Glycolysis / Gluconeogenesis
pha00071  Fatty acid degradation
pha00350  Tyrosine metabolism
pha00625  Chloroalkane and chloroalkene degradation
pha00626  Naphthalene degradation
pha01100  Metabolic pathways
pha01110  Biosynthesis of secondary metabolites
pha01120  Microbial metabolism in diverse environments
pha01130  Biosynthesis of antibiotics
pha01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSHAb0511 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    PSHAb0511 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PSHAb0511 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PSHAb0511 (adhP)
   00626 Naphthalene degradation
    PSHAb0511 (adhP)
Enzymes [BR:pha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PSHAb0511 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C adh_short 3HCDH_N NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: CAI89548
UniProt: Q3ICG9
Position
II:575652..576662
Genome map
AA seq 336 aa AA seqDB search
MKAAINNEFKGKLQIIDMPIPEVGINDVLVKIAACGVCHTDLHACHGDWPVAPKMPLVPG
HEGVGVIEKVGSNIKHLEVGDRVGVPWLYSACGHCEFCLDGRETLCLSQHNTGYSIDGSY
AEYCLAHGDYVVKIPEGLGFSEAAPLFCAGVTTYKALKVSGAKPGQWVAIVGVGGLGHLA
VQYAKAMGFNVIAVDTGKEKLALAKELGADITLDFKEVVPSEAIFEQVGGAHAVVCTAVS
KPGFEQAYKSVRRGGKCVLVGLPPEDMPLPIFDTVLNGVSVVGSIVGTRKDLQECLEFAA
QGKVKAIIEEKRLEDINEIFDDMLKGEINGRIVVTI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcaattaataatgaatttaaaggtaaattacaaataatagacatgcctatc
ccagaggttggcataaatgatgtattggtaaaaatagcggcctgtggggtgtgtcatacc
gatttacatgcatgtcatggcgattggcctgttgcgcctaaaatgcctttagtgccaggc
cacgaaggcgtaggtgtaattgaaaaggtcggtagcaatattaaacacctagaagtaggc
gatcgcgttggtgtgccttggctttacagtgcctgtgggcattgtgagttttgcttagat
ggcagagaaaccctgtgtttgtcacagcataataccggctactctatagatggtagttac
gccgaatattgtttagcacacggtgactacgtggtaaaaatacccgaagggcttggcttt
tcagaagccgcgccattattttgcgctggagtaaccacgtataaagcacttaaagtatcg
ggagctaaacccgggcaatgggtggctattgtgggagtgggcggtcttgggcacttagct
gtacagtatgctaaagcaatggggtttaatgttatagcggttgataccggcaaagaaaaa
ctcgcgctggccaaagagcttggcgcagatattaccctcgactttaaagaagtggttcca
agcgaagccatttttgaacaagtaggcggcgcgcatgcagttgtatgtactgcagtttca
aagcctggttttgagcaagcttataaaagtgtacgtcgtggtggtaagtgtgtgttagtg
ggtttaccgccagaggatatgccattacctatttttgacacagtattaaatggtgtgtca
gttgtgggctctattgtaggtactcgaaaagatttacaagagtgcttagaatttgcagca
caaggtaaagtaaaagcaattattgaagaaaaacgcttagaggatattaacgaaattttt
gatgatatgctcaaaggcgaaattaacggtcgtatagttgttactatctga

DBGET integrated database retrieval system