KEGG   Pseudoalteromonas haloplanktis: PSHAb0511Help
Entry
PSHAb0511         CDS       T00282                                 

Gene name
adhP
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PSHAb0511 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSHAb0511 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    PSHAb0511 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PSHAb0511 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PSHAb0511 (adhP)
   00626 Naphthalene degradation
    PSHAb0511 (adhP)
Enzymes [BR:pha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PSHAb0511 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:575652..576662
Genome map
AA seq 336 aa AA seqDB search
MKAAINNEFKGKLQIIDMPIPEVGINDVLVKIAACGVCHTDLHACHGDWPVAPKMPLVPG
HEGVGVIEKVGSNIKHLEVGDRVGVPWLYSACGHCEFCLDGRETLCLSQHNTGYSIDGSY
AEYCLAHGDYVVKIPEGLGFSEAAPLFCAGVTTYKALKVSGAKPGQWVAIVGVGGLGHLA
VQYAKAMGFNVIAVDTGKEKLALAKELGADITLDFKEVVPSEAIFEQVGGAHAVVCTAVS
KPGFEQAYKSVRRGGKCVLVGLPPEDMPLPIFDTVLNGVSVVGSIVGTRKDLQECLEFAA
QGKVKAIIEEKRLEDINEIFDDMLKGEINGRIVVTI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcaattaataatgaatttaaaggtaaattacaaataatagacatgcctatc
ccagaggttggcataaatgatgtattggtaaaaatagcggcctgtggggtgtgtcatacc
gatttacatgcatgtcatggcgattggcctgttgcgcctaaaatgcctttagtgccaggc
cacgaaggcgtaggtgtaattgaaaaggtcggtagcaatattaaacacctagaagtaggc
gatcgcgttggtgtgccttggctttacagtgcctgtgggcattgtgagttttgcttagat
ggcagagaaaccctgtgtttgtcacagcataataccggctactctatagatggtagttac
gccgaatattgtttagcacacggtgactacgtggtaaaaatacccgaagggcttggcttt
tcagaagccgcgccattattttgcgctggagtaaccacgtataaagcacttaaagtatcg
ggagctaaacccgggcaatgggtggctattgtgggagtgggcggtcttgggcacttagct
gtacagtatgctaaagcaatggggtttaatgttatagcggttgataccggcaaagaaaaa
ctcgcgctggccaaagagcttggcgcagatattaccctcgactttaaagaagtggttcca
agcgaagccatttttgaacaagtaggcggcgcgcatgcagttgtatgtactgcagtttca
aagcctggttttgagcaagcttataaaagtgtacgtcgtggtggtaagtgtgtgttagtg
ggtttaccgccagaggatatgccattacctatttttgacacagtattaaatggtgtgtca
gttgtgggctctattgtaggtactcgaaaagatttacaagagtgcttagaatttgcagca
caaggtaaagtaaaagcaattattgaagaaaaacgcttagaggatattaacgaaattttt
gatgatatgctcaaaggcgaaattaacggtcgtatagttgttactatctga

DBGET integrated database retrieval system