KEGG   Pantholops hodgsonii (chiru): 102314846Help
Entry
102314846         CDS       T02909                                 

Gene name
PADI1
Definition
peptidyl arginine deiminase, type I
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
phd  Pantholops hodgsonii (chiru)
Brite
Enzymes [BR:phd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     102314846 (PADI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 663 aa AA seqDB search
MAQQRAVRLSPKKPSYAVCAVGVETHLDVHSDVPEGAENFGVSGSSGVKIFMVYDPARVT
EPTGRAHWPLDASVDVVISVDAASKALNDLKVKISYFGQPVGRALGHSVLYITGADISLD
ADTGRTGKAKRSQGNKESWRWGPEGYGAILLVNCDRDSLRSTGTDLTNTQLASQDDLQDM
SPVVLTCDAPDALFDSYKLVLNVPLSDSKRMRVFCARGGNSLLDYEQVLGPQHPSYEVAH
QPGKQRIQLYVEGLSFPDANFLGLVSLSVSLVDTKTLPEVPLFTDTVTFRVAPWIMTPNT
QPPLEVYVCSVLDSHGSNAKFLNDMSDLALKASCKLMVCPWVENRNDRWIQDEMEFGYTE
APHKAFPVVFDSPRNRGLKDLPYKRILGPDFGYVTREIQVAGASGLDSFGNLDVSPPVVV
EGKEYPLGRILIGSCLPRSGGRRMAKVVRDFLGAQQVQAPVEVYSDWLSVGHVDEFLSFV
PASDQKGFRLLLASPSACLKLFQEKKEEGYGEAAQFDGLEHQVKRSINEMLADRRLRNDN
LYAQRCIDWNREVLKRELGLTEQDIVDVPQLFSLNGAYAEAFFPDMVNMVVLGRHLGIPK
PFGPVINGRCCLEEKVRPLLEPLGLRCVFIDDYLSYHKLRGEIHCGTNVRRKPFPFKWWH
VVP
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcagagagccgtgcgactgtccccgaagaagcccagctacgccgtgtgtgct
gtgggggtcgagacacacctggacgttcacagtgatgtgcccgagggcgctgagaacttt
ggggtgtctgggagctccggggtgaagatcttcatggtctatgacccagcgcgggtgaca
gagcccacaggcagggcccactggcccctggatgccagcgtggacgtggtcatatccgtg
gatgcagccagtaaggctttaaacgacctcaaggtgaagatctcctatttcgggcagccg
gtgggccgggccctgggccacagcgtgctctacatcacgggcgccgacatctccctcgat
gctgacaccggccgcacgggcaaggcgaaaaggagccaaggcaacaaggaaagctggcgc
tggggccctgagggctatggggccatcctgctggtgaactgcgaccgggacagcctcagg
tccacggggacggacctcaccaacacccagctggcctcgcaggatgacctgcaggacatg
tccccagtggtgctgacctgcgacgcccctgacgcgctctttgacagctacaagctggtc
ttgaacgtgccgctttctgattccaaaagaatgcgggtcttctgcgcccggggcgggaat
tccctcctggactacgagcaggtgctgggaccccagcacccgtcgtacgaagtggcccat
cagcctgggaagcagaggatccagctctatgtggaggggctcagctttcccgacgctaac
ttcctggggctggtctccctcagcgtcagcctggtagacaccaagactctgcccgaggtg
cccctcttcacagacaccgtgaccttccgcgtggccccctggatcatgacccccaacacc
cagccccccctggaggtgtatgtgtgcagtgtcctagactctcacggctcgaatgcgaag
tttctgaatgacatgtccgatctggcgctgaaggccagctgcaagctgatggtctgccct
tgggttgagaaccgaaatgaccgctggatccaggatgagatggagtttggctacactgag
gccccgcacaaagccttccccgtggtcttcgactccccccgaaacagaggcctgaaggat
ctcccttataagaggatactgggtcctgactttggatacgtaacccgggaaatccaggtc
gccggtgcctctggccttgactccttcggcaacctggacgtcagcccgccagtcgtggtg
gagggcaaggagtatcccctgggccggatcctcatcggcagctgcctccccaggtctggc
gggcggcgcatggccaaggtggtgcgggacttcctgggtgcccagcaggtgcaggcgccc
gtggaggtctattctgactggctctctgtgggccacgtggacgagttcctcagcttcgtg
cctgcctccgaccaaaagggcttccggcttctcctggccagccccagtgcatgcctcaag
ctgttccaagagaagaaagaggagggctatggggaagcagcccagtttgacggcttagag
caccaggtaaagagaagcattaatgagatgctggcagacaggcgtctcaggaacgacaac
ctctatgcacagaggtgcatcgactggaaccgggaggtgctgaagcgggagctgggcctc
actgagcaggacattgtggacgtcccgcagctgttctccctgaatggcgcctacgcagaa
gccttcttccccgacatggtgaacatggtggtcttaggcaggcacctgggcatccccaag
cccttcgggcccgtcatcaacggccgctgctgcctggaggagaaggtgcggcccctgctg
gagccgctgggcctccgctgtgtcttcatcgacgactacttatcctaccacaagctgcgc
ggcgagatccactgcggcaccaacgtgcgccggaagcccttccccttcaaatggtggcac
gtggtgccctga

DBGET integrated database retrieval system