KEGG   Pantholops hodgsonii (chiru): 102314919Help
Entry
102314919         CDS       T02909                                 

Definition
UDP-glucuronosyltransferase 2B17-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:phd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102314919
   00053 Ascorbate and aldarate metabolism
    102314919
   00500 Starch and sucrose metabolism
    102314919
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102314919
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102314919
   00860 Porphyrin and chlorophyll metabolism
    102314919
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102314919
   00982 Drug metabolism - cytochrome P450
    102314919
   00983 Drug metabolism - other enzymes
    102314919
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    102314919
Enzymes [BR:phd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102314919
Glycosyltransferases [BR:phd01003]
 Others
  Hydrophobic molecule
   102314919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 535 aa AA seqDB search
MNKMSTKWLSLLLLLQLTCYFSSGSCGKVLAWPVEFSHWMNMKAVLDELVMRGHEVTVLI
SSASTITDANKPSALKFEIFPVSLTKDDFENAVKNLIEKWTYMAKSSFWTNVLSFNELKS
LLWEFSGMLMKMCKEVVSKKKLISKLQESKFDVLLADAVGPCGELLTEILGIPLVYSLRF
SPGYLFEKYSGQLSFPPSYVPVILSALSDHMTFMERVKNMIYVLYFDFCFQTFDMKTWNE
FYSEVLGRPATFLETIGKADMWLIRTYWDFEFPRPVLPNFEFVGGLHCKPAKPLPKEMEE
FVQSSGENGIVVFTLGSMISNITEEKVNVIASALAQIPQKVLWRYDGKTPDTLGPNTRLY
KWIPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGLPLFADQPDNIARVKAKGAAVR
VDLETMSARDLLSALKEVINNPYYKEKAMWLSTIQRDQPIKPLDRAVFWIEFVMRHKGAK
HLRPAAHNLTWFQYHSLDVIGFLMACVATVVFVITKCFLFCYCKFAKTGKKQKRE
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaatgtctacgaaatggctctcacttctgctgctgctacagctgacttgctac
tttagctctgggagttgtggaaaggtgctggcgtggccagtggaatttagtcattggatg
aatatgaaggcagttctggatgaactagtcatgaggggtcatgaggtgactgttctaata
tcttcagcttccactattactgatgccaacaaaccatctgctttaaagtttgagattttc
cctgtatctttaactaaagatgattttgagaatgctgtcaagaatttgattgagaaatgg
acgtatatggcaaaaagttcattttggacaaatgttttatcttttaacgagttgaaaagc
ttactttgggaattttctggaatgcttatgaaaatgtgtaaagaagttgtttcaaaaaag
aaacttatatcaaaactacaggaatcaaagtttgatgtccttcttgcagatgctgttgga
ccctgtggtgagctgctgactgagatacttggaataccgttagtgtacagtctccgtttt
tcacctggctatttgtttgaaaaatatagtggacaactttcattcccaccatcctatgta
cctgtgatattatcagcattaagtgatcacatgacatttatggaaagggtcaaaaatatg
atatatgtactttattttgacttctgtttccagacatttgacatgaagacatggaatgag
ttttacagtgaagtactaggaagacccgctacatttttagagacaattggaaaagctgat
atgtggctcattcgaacctattgggattttgaatttcctcgcccagtgctgccaaatttt
gaatttgttggaggcctccactgtaaacctgccaaacccctgcctaaggaaatggaagag
tttgttcagagctctggagaaaatggtattgtagtgtttactttagggtcaatgatcagt
aacataacagaagaaaaagtcaatgtaattgcatcagctcttgcccagattccacaaaaa
gttctctggagatatgatggcaagacaccagataccctagggcccaatactcgtctgtat
aagtggataccccagaatgaccttcttggtcaccccaaaaccaaagcatttataactcat
ggtggaaccaatggcatttatgaggccatctaccatgggatccctatggtgggccttcct
ttgtttgctgatcagcctgataacattgcccgagtaaaagccaagggagcagctgtcaga
gtggacttggaaacaatgtcagcaagagatctgctcagtgcattgaaggaagtcattaac
aatccttactacaaagagaaggctatgtggttatccaccattcaacgcgatcagcctata
aagcccctggaccgagcagtcttctggattgagtttgtcatgcgccacaaaggagccaag
cacctgaggccagctgcccacaacctcacctggttccagtaccactctctggatgtgatt
gggttcctgatggcctgtgtggcaactgttgtatttgtcatcacaaaatgctttctgttt
tgttactgcaagtttgctaaaacaggaaagaagcaaaaaagggagtag

DBGET integrated database retrieval system