KEGG   Pantholops hodgsonii (chiru): 102315534Help
Entry
102315534         CDS       T02909                                 

Gene name
POR
Definition
P450 (cytochrome) oxidoreductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
phd  Pantholops hodgsonii (chiru)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 634 aa AA seqDB search
MNMGDSNVDTGTTTPEAVAEEVSLFSATDTILFSLIVGVMTYWFLFRKKKEEVPEFTKIQ
TATSSVKDRSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMAADPEEYD
LADLSSLPEIEKALAVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKYAVFALGNKTY
EHFNAMGKYVDKRLEQLGAQRIFDLGLGDDDGNLEEDFITWREQFWPAVCEHFGVEATGE
ESSIRQYELVVHTDMDMAKVYTGEMGRLKSYENQKPPFDAKNPFLAVVTTNRKLNQGTER
HLMHLELDISDSKIRYESGDHVAVYPANDSALVNQLGEILGADLDVIMSLNNLDEESNKK
HPFPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPAEQEQLRKMASSSGEGKELYLR
WVLEARRHILAILQDYPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVAVEY
ETKTGRINKGVATSWLRREEPAGENGGRALVPMFVRKSQFRLPFKATTPVIMVGPGTGVA
PFIGFIQERAWLRQPRPQVYVQHLLKKDKEHLWKLIHEGGAHIYVCXDARNMARDVQNTF
YDIAAEQGAMEQAQAVDYIKKLMTKGRYSLDVWS
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgggagactccaacgtggacaccggcaccaccacgcctgaggcggtggctgaa
gaagtgtcccttttcagcgcgacggacacaatcctgttttctctcatcgtgggtgtcatg
acttactggttcctcttcaggaagaagaaagaagaagtccccgagttcaccaagattcag
accgcgacctcctctgtcaaagacagaagctttgtggagaagatgaagaagacgggcagg
aacatcatcgtgttctatggctcccagacggggactgctgaggagtttgccaaccgcctg
tccaaggacgcccaccgctacgggatgcggggcatggcagctgaccccgaggagtatgat
ctggctgatctgagcagcctaccagagattgagaaagccctggctgtgttctgtatggct
acctacggtgagggggaccccactgacaatgcccaggacttctacgactggctccaggag
acggatgtggacctctctggggtcaagtacgcggtgtttgcccttgggaacaagacctac
gagcacttcaacgccatgggcaagtacgtggacaagcggctggaacagctcggggcccag
cgaatctttgatctggggctgggcgacgacgacgggaacctggaggaggacttcatcacg
tggcgagaacagttctggccggccgtgtgcgagcacttcggagtggaagccaccggggag
gagtccagcattcgccagtatgaactcgtggtccacacggacatggacatggccaaggtg
tacacgggcgagatgggccgcctgaagagctatgagaaccagaaaccccccttcgacgcc
aagaacccgttcctggctgtcgtcaccaccaaccggaagctgaaccagggaaccgagcga
cacctcatgcacctggaattagacatctcggactccaaaatcaggtatgagtctggggac
catgtggctgtttatccggctaatgactctgccctggtgaaccagcttggcgagatcctg
ggtgctgacctggatgtcatcatgtccctgaacaaccttgatgaggagtccaacaagaag
caccccttcccctgccccacctcctaccgcacggccctcacctactacctggacatcacc
aacccgccgcgcaccaacgtgctctacgagctggcccagtacgcctcggagcccgccgag
caggagcagctgcgcaagatggcctcctcatcgggcgagggcaaggagctgtacctgagg
tgggtgctggaggctcggcggcacatcctggccatcctgcaggactacccgtccctgcgg
ccccccatcgaccacctgtgtgagctgctgcctcgtctccaggcccgctactactccatt
gcctcgtcttccaaggtccaccccaactccgtgcacatctgcgccgtggccgtggagtac
gaaaccaagacgggccgcatcaacaagggcgtggccaccagctggctgcggcgcgaggag
ccggccggggagaacggcggccgggccctggtgcccatgttcgtgcgcaagtcccagttc
cgcctgcccttcaaggccaccacacccgtcatcatggtgggccccggcaccggggtcgcc
cccttcataggcttcatccaggagcgggcctggctaaggcaaccccgcccccaggtctac
gtgcagcacttactcaagaaggacaaggagcacctatggaaactcatccacgaggggggc
gcccacatctacgtgtgcngggacgctcggaacatggcgagagacgtgcagaacaccttc
tatgacatcgcggctgagcagggggccatggagcaggcccaggctgtggactacatcaag
aagctgatgaccaagggccgctactccctggacgtgtggagctag

DBGET integrated database retrieval system