KEGG   Pantholops hodgsonii (chiru): 102316729Help
Entry
102316729         CDS       T02909                                 

Gene name
CHKB
Definition
(RefSeq) choline kinase beta
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd00564  Glycerophospholipid metabolism
phd01100  Metabolic pathways
phd05231  Choline metabolism in cancer
Module
phd_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
phd_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:phd00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    102316729 (CHKB)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    102316729 (CHKB)
Enzymes [BR:phd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     102316729 (CHKB)
    2.7.1.82  ethanolamine kinase
     102316729 (CHKB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase
Motif
Other DBs
NCBI-GeneID: 102316729
NCBI-ProteinID: XP_005957350
Position
Un
AA seq 319 aa AA seqDB search
MAKVAEKLTPASRPSLSLCHWPFVTVVPSLSIFLQGVDSLVLESVMFAILAERSLGPQLY
GVFPEGRLEQYIPSRPLKTHELRDPVLSAAIATKMGKFHGMEMPFTKEPHWLFGTMERYL
KQIQDLPPTGLPQTNPLEMYRLKDEMGSLRKLLDTTPSPVVFCHNDIQEGNILLLSEPKS
TDSLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTHEEWPFYKAQPANYPTEGQQLHFIRHY
LAEVKKGEAISQEEQRKLEADLLVEANRYALASHFFWGLWSILQASMSTIEFGYLEYAQS
RFQFYFQQKGQLTSLHPSS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagtggcggagaaacttactccagcaagtcgaccctcgttgtccctttgccat
tggccctttgtgactgtggtcccttcactgtccatcttccttcagggcgtggactctttg
gtccttgaaagtgtgatgttcgccatacttgcagagcggtcgctggggccccagctctac
ggagtctttccggagggccggctggaacagtacatcccaagccggccactgaagacacat
gagcttcgagatccagtgttgtctgcagccattgccacgaagatgggcaagttccacggc
atggagatgcctttcactaaggagccccactggctattcgggaccatggagcggtactta
aagcagatccaggacctgccccctaccggccttccccagacgaacccgctggagatgtac
cgcttgaaggatgagatgggcagcctcaggaagctgctagacactaccccatcaccagtg
gtcttttgccacaatgatatccaagaagggaacatcttactgctctcagagcctaaaagc
accgacagcctcatgctggtggacttcgagtacagcagttataactacaggggctttgac
attgggaaccatttttgtgagtgggtttacgattatacccacgaggagtggcctttctac
aaagcgcagcctgcaaactaccccactgagggacagcagctccatttcattcgccactac
ctggcagaggtgaagaaaggtgaggccatctcccaagaggagcagaggaagctggaagca
gatttgctggtggaagctaatcggtatgccctggcatctcatttcttttggggtctctgg
tccattctgcaggcatccatgtccactatagaatttggttacttggagtatgcgcagtct
cggttccagttctacttccagcagaagggccagctgaccagcttgcacccctcatcctga

DBGET integrated database retrieval system