KEGG   Pantholops hodgsonii (chiru): 102319063Help
Entry
102319063         CDS       T02909                                 

Gene name
GTF3C4
Definition
general transcription factor IIIC, polypeptide 4, 90kDa
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
phd  Pantholops hodgsonii (chiru)
Brite
Enzymes [BR:phd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102319063 (GTF3C4)
Transcription machinery [BR:phd03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     102319063 (GTF3C4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 715 aa AA seqDB search
MTAPALPRPSTNAISLKVGSKREVAECKQRFATSEDPTVSQTFMLDRVFNPEGKALPPLR
GFKYTSWSPVGCDANGRCLLAALTMDNRLTIQANLNRLQWVQLVDLTEIYGERLYETSYR
FSRNEAPEGSLRDFAEFQRRHSMQAPVRMEWSGICTTQQVKHNNECRDVGSVLLAVLFEN
GNIAVWQFQLPFAGKESISSCNTIESGISSPSVLFWWEYEHSNRKMSGLIVGSAFGPVKI
LPVNLKAVKGYFTLRQPVVLWKEMDQLPVHSIKCVPLYHPYQKCSCSLVVAARGSYVFWC
LLLISKAGLNVHNSHVTGLHSLPIVSMTADKQNGTVYTCSSDGKVRQLIPIFTDVALKFE
HQLIKLSDVFGSVRTHGIAVSPCGAYLAVITTEGMVNGLHPVNKNYQVQFVTLKTFEEAA
AQLLESSVQNLFKQVDLIDLVRWKILKDKHIPQFLHEALEKKIESSGATYYWRFKLFLLR
ILYQSMQKTPSEALCKPTHEDSKILLVDSPGMGNAEDEQQEEGTSSKQISKQGKDGDPED
PTEDSLPQSGDTGGREPMEEKLLEIQGKIEAVEMHLTREHMKRVLGEVYLHTWITENTSI
PTRGLCNFLMSDEEYDDRTARVLIGHISKKMNKQTFPEHCSLCKEVLPFTDRKQAVCSNG
HIWLRCFLTYQSCQSLIYRRCLLHDSIARHPIPEDPDWIKRLLQSPCPFCDSPVF
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgactgcccctgcactgccccgcccctccaccaacgccataagtttgaaggttggctca
aaaagggaggttgccgagtgcaaacagaggtttgccacctctgaagaccccacagtcagt
cagactttcatgttggacagggtgttcaaccctgaggggaaggctctgccaccgctgaga
gggttcaagtacactagctggtcccccgtgggctgtgacgctaatggcaggtgcctgctg
gccgcactgaccatggacaatcgcctgaccatccaggctaacctcaacagactgcagtgg
gtccagctggtggacctgacggagatttacggagagcgtctctatgagaccagctacagg
ttctccagaaatgaggccccggagggcagtctcagggacttcgccgagttccagaggcga
cacagcatgcaggcgccggtgcggatggagtggtcgggcatctgcaccacgcagcaggtc
aagcacaacaacgagtgccgcgacgtgggcagcgtgctcctggcggtcctcttcgagaac
gggaacatcgccgtgtggcagttccagctcccgttcgcggggaaggagtccatctcttcc
tgcaacaccatcgagtcaggaatcagctctcccagcgttttgttttggtgggaatacgag
cacagcaatcggaaaatgagcggccttattgtggggagtgctttcgggcctgtaaaaatc
cttcctgtcaatcttaaagcagtcaaaggctatttcaccttgcggcagcctgtcgtcttg
tggaaagaaatggaccagttgccagtccacagcatcaagtgcgtgccgctgtaccacccc
taccagaagtgcagctgcagcctggtggtggccgcgcgaggctcctacgtgttttggtgt
cttctcctgatctccaaagcaggtctgaatgtccacaactctcacgtcacaggcctgcac
tccctgcccatcgtctccatgactgccgacaagcagaatgggacggtgtatacttgctcc
agtgacggcaaggtgaggcagctgatccccattttcacagatgtggcgttgaagtttgag
caccagttgattaaactctctgatgtgtttggctccgtgaggacacacgggatagccgtg
agcccctgcggcgcatacctggccgtcatcaccacggagggcatggtcaacggcctccat
cctgttaacaaaaactaccaggttcagttcgttactctcaaaacctttgaagaggcagct
gctcagcttctggagtcttctgtccagaatctctttaagcaggtagatttaatagaccta
gtacgctggaagattttaaaggataagcatatccctcaatttttacatgaagctttggaa
aaaaagattgaaagcagtggggccacctattactggcgtttcaaactcttcctcctgagg
attttataccagtcgatgcagaaaaccccttcagaagccttatgcaaacccacccacgag
gactcaaaaatcttactagttgactcacctgggatgggcaatgctgaggatgaacagcag
gaggaaggcacctcttccaaacagattagtaagcaaggcaaagacggtgatccagaggac
cccacagaggactcactccctcagtctggggatactggaggccgagagccaatggaagag
aagctccttgaaatccagggaaaaattgaagcagtggaaatgcacttgacgagggagcac
atgaagcgagtcctgggcgaagtgtacctgcacacctggatcacagaaaacactagcatc
cccaccaggggactctgtaacttcctgatgtctgatgaggagtatgatgacagaaccgca
cgggtgctgattggacacatctcaaagaagatgaacaagcagaccttccctgagcactgt
agtctgtgtaaggaggtcttgccgttcacagatcgcaagcaggccgtctgctccaatggc
cacatttggctccggtgctttttaacctaccagtcctgccagagtttgatatacagaagg
tgtttgctccatgacagcatcgctcgccatccaattccagaagaccctgactggatcaag
aggttactgcagagcccctgccctttctgcgactctcctgtcttctga

DBGET integrated database retrieval system