KEGG   Pantholops hodgsonii (chiru): 102320187Help
Entry
102320187         CDS       T02909                                 

Gene name
COMT
Definition
catechol-O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:phd00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102320187 (COMT)
  Amino acid metabolism
   00350 Tyrosine metabolism
    102320187 (COMT)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    102320187 (COMT)
Enzymes [BR:phd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     102320187 (COMT)
Exosome [BR:phd04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   102320187 (COMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 234 aa AA seqDB search
MRASGGAGPVRPLPVRDPQVTTALLEASHAFPLCRLSLAVSQGPWAPPLTGDPCYPPKGS
PARGRADLLLIVEQAGGRGAYCGYSAVRIARLLLPGARLLTIELNPDYAAITQRMVEFAG
LQDKVTVILGASQDIIPQLKEKYDVDTLDMVFIDHWKDRYLPDTLLLEECGLLRKGTVLL
ADNVIFPGAPDFLEYVRGSSRFECSHFSSYLEYSKVVDGLEKVVYKGPSDPARP
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcttctggaggagccggtcctgtgcggcccctccctgtgcgtgacccacaagtg
accacagccctgctggaagcttcccacgctttcccactgtgccggctcagcctggctgtg
tctcaggggccctgggcccctccactgactggggacccctgctacccgcccaaagggtcg
cctgccagggggagggccgatctcctgctcatcgtggagcaggcgggcggcaggggcgcc
tactgcggctactcggccgtgcgaattgcccgcctgctgctgccgggcgcccggctgctc
accatcgagctcaaccccgactatgccgccatcacccagcggatggtggagtttgcaggc
ctgcaggacaaggtgactgttattcttggagcatcccaggacatcatcccccagctgaag
gagaaatatgacgtggacacactggacatggtcttcatcgaccactggaaggaccgctac
ctgccggacacgcttctcctggaggagtgcggcctgctgcggaaggggacagtgctgctg
gccgacaacgtcatcttccccggggcgcccgactttctggagtacgtgcgcgggagcagc
cgcttcgagtgctcgcacttcagctcatacctggagtactccaaggtggtggacggcttg
gagaaggtcgtctacaagggcccgagcgaccccgctcggccctga

DBGET integrated database retrieval system