KEGG   Pantholops hodgsonii (chiru): 102320974Help
Entry
102320974         CDS       T02909                                 

Definition
1,4-alpha-glucan-branching enzyme-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102320974
Enzymes [BR:phd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     102320974
Exosome [BR:phd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102320974
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 660 aa AA seqDB search
FALFQRYKRFNQTLSSIGENEGGIDRFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTG
DFNDWNPFSHPYKKLDFGKWELYIPPKQNRSVLVPHGSKLKLVIRSKSGEILYRISPWAK
YVTREGSNVNYDWIHWDPEYLYKFKHSKPKKPKGLRIYESHVGISSYEGKIASYKHFTCN
VLPRIKDLGYNCIQMMAIMEHAYYASFGYQITSFFAASSRYGTPEELKELVDTAHSMGIT
VLLDVVHSHASKNSEDGLNMFDGTESGYFHYGPRGTHILWDSRLFDYASWEVLRFLLSNI
RWWLEEYGFDGFRFDGVTSMLYHHHGIGENFSGDYHEYFGLQVDEDALTYIMLANHLVHT
LYPDSITIAEDVSGMPALCSPISQGGGGFDYRLAMAIPDKWIQLLKEYKDEDWNMGNIVY
TLTNRRYLEKCIAYAESHDQALVGDKTLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKM
IRLITHALGGEGYLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNN
FDRDMNKLEERCGWLSAPQAHVSEKHEDNKVIAFERASLLFIFNFHPGNSYTDYRVGTTL
PGKYKIVLDSDAAEYGGHKRLDHNTEFFSEPFEHNNCPCSLLVYIPSRVALILRNVDLPN
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
tttgcactttttcaaaggtataagcggtttaaccagactttgagcagcattggagagaat
gaaggtggaattgataggttttccagaggttatgaatcatttggcgtccacagatgtgct
gatggtggtttatactgcaaagaatgggccccaggagctgaaggagtttttcttactgga
gacttcaatgattggaacccattttcacacccatataaaaaactggattttggaaaatgg
gagctgtatatcccaccaaagcagaatagatctgtcttagtacctcatggatccaaacta
aagcttgttatcaggagtaaaagtggagaaatcttgtaccgtatttcaccgtgggcaaaa
tatgtgactcgtgaaggcagtaatgtgaactatgattggatacactgggatccagaatac
ttgtataaatttaaacattccaaaccaaagaagccaaaaggtctacgaatttatgaatct
cacgtgggaatttcttcctatgaaggaaaaatagcttcttataaacattttacatgcaat
gtactaccaagaatcaaagaccttggatataattgcattcagatgatggcaatcatggaa
catgcttactatgccagttttggttaccaaatcacaagcttctttgcagcttcaagccgt
tatggaactcctgaagagctgaaagagctggttgatacagctcattccatgggtattaca
gtcctcttagatgtggtacacagccatgcctcaaaaaattcagaagatggactaaatatg
tttgatgggactgagtccggttactttcattatggacctagagggactcatattctatgg
gatagtcggttatttgactacgccagctgggaagttttaagatttcttctgtcaaacata
agatggtggttggaagagtatggctttgatggatttcgttttgacggtgttacatcaatg
ctctatcatcaccatggaataggtgagaatttttcaggtgattaccatgagtattttgga
ctacaagtagatgaagatgctttgacttacatcatgttggcaaatcatttggttcacaca
ctgtatccagattctataacaatagctgaggatgtatcaggaatgccagctctgtgttct
ccaatttcccagggagggggtggttttgactatcgattggccatggcaattccagataaa
tggatacagttactgaaagaatataaagatgaagattggaacatgggcaatatagtgtat
acactcacaaaccgacgctaccttgaaaagtgcattgcctacgcagagagccacgatcag
gcacttgttggggataagacgttggcattttggttgatggatgctgaaatgtataccaac
atgagtgttctgaccccatttactcccgttattgatcgtggaatacagcttcataagatg
atacgactcattactcacgcacttggtggagaagggtatctcaatttcatgggtaatgaa
tttgggcatcctgaatggttagacttcccaagaaaaggaaataatgagagctaccattat
gcacgaaggcagtttcatttaactgatgatgatcttcttcgctataagttcctgaataac
tttgacagggatatgaataaattggaagaaagatgtggttggctttcagctccacaggcc
catgtgagtgaaaagcatgaagacaataaggtcattgcttttgagagagctagtcttctt
ttcatcttcaactttcatccaggcaatagctatactgattaccgagttggaacaacattg
ccaggaaagtacaaaattgtgctcgattcagatgcagcagaatacggaggacacaagaga
ctggaccacaataccgaattcttctcggaaccttttgaacataataactgtccctgttct
cttttggtgtacattccaagccgagtggccctcatccttcgcaatgtggacctgcccaac
tga

DBGET integrated database retrieval system