KEGG   Pantholops hodgsonii (chiru): 102322688Help
Entry
102322688         CDS       T02909                                 

Gene name
GBA
Definition
glucosidase, beta, acid
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:phd00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102322688 (GBA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102322688 (GBA)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    102322688 (GBA)
Enzymes [BR:phd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     102322688 (GBA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 591 aa AA seqDB search
MHRVSAEPCSAAPPTSFTGCFGISFRLRLGLLFRFTDVDPLSLRSLGTPTSSCLVMELSS
PSREEYPVPRGRVEIMAASLMGLLLLHTVSWVSGARPCIPKSFGYSSVVCVCNATYCDSL
DPLTLPDPGTFSRFESTRSGRRMELSLGTIQANRTGTGLLLTLQPDQKFQKVKGFGGAVT
DAASLNILALSPAARNLLLKSYFSEEGIEYNIIRVPMASCDFSIRTYTYDDSPDDFQLLN
FSLPEEDVKLKIPLIHQALELANRSVSLFASPWTSPTWLKTNGAVNGKGTLKGQPGDLYH
KTWARYFVKFLDAYAEHKLRFWAVTAENEPTAGLLSGYPFQCLGFTPEHQRDFIARDLGP
ILANSTHRDVRLLMLDDQRLLLPRWAQVVLADPEAAKYVHGIAVHWYLDFLAPAKATLGE
THRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLALN
PEGGPNWVRNFVDSPIIVDIAKDTFYKQPMFYHLGHFSKFIPEGSQRVGLAASEKSDLDT
VALFRPDGSAGVVVLNRSSKDVPLTIKDPAVGFMETVSPGYSIHTYLWRRQ
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgtgtctccgcggagccctgttctgcagccccgcctaccagctttacaggctgc
tttgggatttcctttcgcctccggttggggctgctgtttcgcttcaccgacgttgatcct
ctatccctcagaagtttgggaaccccaacgtcttcttgcctggtgatggagctttcaagt
ccttccagagaggagtatcctgtgcctcggggcagagtagaaatcatggctgccagcctc
atgggattacttctacttcatacagtgtcatgggtatcaggtgcccgcccctgcatccct
aaaagctttggctacagctcggtggtgtgtgtctgcaatgccacatactgtgattctctg
gaccccctgaccctgcctgaccctggcaccttcagccgctttgagagcactcgcagcggg
cgccgaatggagctgagtctggggaccatccaggccaatcgcacaggcacagggttgctg
ttgaccttgcagccagatcagaaattccagaaagtgaaggggtttggaggggccgtgacg
gatgctgcttccctcaacatccttgccctgtcacctgctgcacggaatttgctgctcaaa
tcgtacttctccgaagaaggaattgaatacaacatcatccgggtccccatggccagctgt
gacttctccatccgcacctatacctatgacgacagccctgatgacttccagttgctcaac
ttcagccttccagaggaagatgtcaagctcaagataccactgattcaccaagctctggag
ttggccaaccgctctgtctcactctttgccagtccctggacatcacccacttggctcaag
actaatggggccgtgaatgggaaggggacactcaagggtcagccaggggatctctaccac
aagacctgggccagatactttgtcaagttcctggatgcctacgcggagcacaagttacga
ttctgggcagtgacagctgagaacgagcctactgcagggctccttagcgggtaccccttc
caatgcttgggtttcactcctgagcaccagcgagacttcattgcccgtgacctgggtccc
atcctcgccaacagtacacaccgtgacgtccgactgttgatgctggatgaccagcgcttg
ctgttgcctcgctgggcccaggtggtgctggcagacccagaagcagctaagtatgttcat
ggcatcgctgtacattggtacctagacttcctggctccagcaaaagccaccctgggggag
acgcaccgcctgttccccaacaccatgctctttgcttcagaggcctgtgtgggctccaag
ttctgggagcagagcgtgcggctgggctcctgggatcgagggatgcaatacagccacagt
atcatcacaaacctcctctaccatgtggttggctggaccgactggaacctcgccctaaat
cctgaagggggacccaactgggtgcgcaactttgttgatagccccatcattgtggatatc
gccaaggacacattttacaaacagcctatgttttaccaccttggccacttcagcaagttc
attcccgagggctcgcagagagtggggctggctgccagcgagaagagtgacttggacacg
gtggcactctttcggcctgatggctctgcgggtgtggtcgtgctgaaccgctcctctaag
gacgtgcctctcaccatcaaggatcccgccgtgggcttcatggagactgtctcacctggc
tactccattcacacctacctgtggcgtcgccagtga

DBGET integrated database retrieval system