KEGG   Pantholops hodgsonii (chiru): 102326656Help
Entry
102326656         CDS       T02909                                 

Gene name
KAT2A
Definition
K(lysine) acetyltransferase 2A
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:phd00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102326656 (KAT2A)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102326656 (KAT2A)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    102326656 (KAT2A)
  Infectious diseases
   05166 HTLV-I infection
    102326656 (KAT2A)
Enzymes [BR:phd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102326656 (KAT2A)
Transcription machinery [BR:phd03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102326656 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 765 aa AA seqDB search
MAEPSQASTPAPAAQPRPLQSPAPAPTPTPTLSPASYFCFQANETCKCNGWKNPKPPTAP
RMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDT
DTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPRERQ
TMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTRWLCYCHVPQSCDSLPRYE
TTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGANS
PIWESGFTMPPSEGTQLVPRPATVSAAVVPSAPIFSPTMGGSSNSSLSLDSGGAEPMPGE
KRKLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARL
EERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLA
LIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLT
YADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQK
EIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQ
LYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKL
FVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaccttcccaggcctctaccccggcccctgccgcgcagccccgtccgcttcaa
tccccagcccctgccccaactccgactcctaccctcagcccagcttcgtatttctgcttc
caggccaatgaaacctgcaagtgtaatggctggaaaaaccccaagccccccactgcaccc
cgcatggatctgcagcagccagcggcgaacctgagcgagctgtgccgcagctgtgagcac
cctttggctgaccacgtgtcccacctggagaacgtgtcagaggatgagattaaccggctg
ctggggatggtggtggacgtggagaatctgttcatgtctgttcataaggaggaggacacg
gacaccaagcaggtctatttctacctcttcaagctcctgcggaaatgcatcctgcagatg
acccggcctgtggtggaggggtccctgggcagccccccatttgagaagcctaatattgag
cagggcgtgctaaactttgtgcagtacaagtttagtcacctggctccccgggagaggcag
acgatgttcgagctctcaaagatgttcctgctctgccttaactactggaagcttgagaca
cctgcccaatttcggcagaggtctcaggccgaggatgtggctacctacaaggtcaattac
accagatggctctgctactgccacgtgccccagagctgcgatagcctcccccggtatgag
accactcatgtcttcgggcgcagccttctccgctccatcttcacggttacccggcgacag
ctgctagagaagttccgagtagagaaggacaagctggtgcctgagaagaggaccctcatc
ctcacccacttccccaaattcctgtccatgctggaggaggagatctatggggcaaactct
ccgatctgggagtcgggcttcaccatgccgccctcagagggaacgcaactggtgccccgg
ccagctacggtcagcgctgcagttgttcccagtgcccccatcttcagccccaccatgggt
gggagcagcaacagctccttgagcctggattccggaggcgctgagcccatgccaggcgag
aagaggaagctcccagagaacctgaccctggaggacgccaagcgtctccgtgtgatgggt
gacatccccatggagctggttaacgaggtcatgctcaccatcaccgaccccgccgccatg
ctagggcccgagacgagcctgctgtcggccaacgctgcccgggatgagactgctcgcctg
gaagagcgccgaggcatcattgaattccacgtcatcggcaactcactcacacccaaggcc
aatcggcgggtgttgctgtggctggttgggctacagaacgtcttctcccaccagctgccg
cgaatgcccaaggagtacattgcccgcctcgtctttgacccgaagcacaagactctggcc
ttgatcaaggatgggcgggtcattggtgggatttgcttccgcatgtttcccacccagggc
ttcacggagatcgtcttctgtgctgtcacctccaatgagcaggtcaagggctatggcact
cacctgatgaaccacctgaaggagtatcacatcaagcacaacattctctacttcctcacc
tacgccgacgagtacgccatcggctacttcaagaagcagggcttctccaaggacatcaag
gtgcccaagagccgctacttgggctacatcaaggactacgagggtgcgacactgatggag
tgtgagctaaaccctcgaatcccctacacagagctgtcccacatcatcaagaagcagaag
gagatcatcaagaagctgattgagcgcaaacaggctcagatccgaaaggtctatcccggg
ctcagctgcttcaaggagggtgtgcgccagatccctgtggagagcgtccctggcattcga
gagacaggctggaagccactagggaaggagaaagggaaggagttgaaggaccctgaccag
ctctacacaaccctcaaaaacctgctggcccagatcaagtcccaccccagtgcctggcct
ttcatggagcccgtgaagaagtcggaggccccagactactacgaggtcatccgcttcccc
atcgacctgaagaccatgacagagaggctgcgcagccgctactatgtgacccggaagctc
tttgtggccgacctgcagcgggtcattgccaactgccgcgagtacaaccccccggacagc
gagtactgccggtgcgccagcgccctggagaagttcttctacttcaagctcaaggagggc
gggctcattgacaagtag

DBGET integrated database retrieval system