KEGG   Pantholops hodgsonii (chiru): 102327061Help
Entry
102327061         CDS       T02909                                 

Gene name
SIRT6
Definition
sirtuin 6
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:phd00001]
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    102327061 (SIRT6)
Enzymes [BR:phd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102327061 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 359 aa AA seqDB search
MSVNYAAGLSPYADKGKCGLPEVFDPPEELEQKVWELAQLIWQSSSVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPKFDTTFENAQPTKTHMALVQLERVGLLRFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECVKCKTQYVRDTVVGSMGLKPTGRLCTVAKSRGLRACRGE
LRDTILDWEDSLPDRDLTLADEASRSADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVN
LQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPHVVERALPPLPRPPAPKLEPK
EEASPQFDSPVPASPKQEPTAEPCTQHNGSGPTSPKREQPDSPAPHRPPKRVKTEVVPS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattacgcggcggggctttcgccgtatgcggacaaaggcaagtgcggtcta
cccgaggtcttcgacccccccgaggaattggagcagaaggtgtgggagctcgcacagctc
atctggcagtcctccagtgtggtgttccacacaggcgcaggcatcagcactgcctcaggc
atccccgacttcaggggcccccatggcgtctggacgatggaggagcgaggcctggccccc
aagttcgacaccacctttgagaatgcccagcccacaaagactcacatggcgctggtgcag
ctggagcgcgtgggcctcctgcgcttcctggtcagccagaacgtggacggactgcacgtg
cgctccggcttccccagagacaagctggcagagctccacggaaacatgtttgtagaagaa
tgtgtcaagtgtaagacgcagtatgtccgggacaccgtggtgggcagcatgggcctgaaa
cccacgggccggctctgcaccgtggccaagtccaggggactgcgggcctgcaggggggag
ctgagagacaccatcctggattgggaggattccctgcctgaccgggacctcaccttggcc
gacgaggccagcaggagtgcagacctgtccatcacactgggcacctccctgcaaatccgg
cccagcgggaaccttcccctcgccaccaagcgccgtggaggtcgcctggttatcgtcaac
cttcagcccaccaagcacgaccgccacgcagacttgcgaatccacggttatgttgatgag
gtcatgacacggctcatgaaacacctgggcctggagatcccggcctgggacggcccccac
gtggtggagagggcactgccgcccctgccacgcccacctgcccccaagctggagcccaag
gaggaggcctccccccagttcgacagcccagtgcctgccagccccaagcaggaacccaca
gctgagccctgcacccagcacaatggttccggacccaccagccccaaaagggagcagccg
gacagccctgcccctcacaggcctcccaaaagagtgaaaactgaggtggttcctagctga

DBGET integrated database retrieval system