KEGG   Pantholops hodgsonii (chiru): 102327808Help
Entry
102327808         CDS       T02909                                 

Gene name
CES3
Definition
carboxylesterase 3
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
phd  Pantholops hodgsonii (chiru)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 570 aa AA seqDB search
MGTVVRTGSGVLVWVACLLLAFSGTDTGAGVTQPEVDTLLGRVRGRQVGVKGTDRLVNVF
LGIPFAQPPLGPHRFSAPGPAESWEGVRDASRAHAMCLQDLERMNNSRFTLDGKHQTFPI
SEDCLILNIYSPAEAPSGAGRPVMVWFHGGSLVTGTATSHDGSALAAYGDVVVVTAQYRL
GFLGFFSTGDKHAPGNWGFLDAVAALRWVQGNITPFGGDFNSVTIFGESSGASVVSALVL
SPLAAGLFHRAIAQSGIITVPGLLDPDPWLLAQSLADSLACNSDSSAEMVQCLRQKTSEE
MILAYKSKKIASYNIDGTFFPKSAEELLRERQFPSVPFLFGVNNHEFGWLIPRGWGFLDK
MDQLSLEDMLAILRPYLTNMDVPTEVMPTIIKEYLGSRSDGQAKREAFQELISDIIIIFP
MLQFARDLQDSGVSIFFYEFQHRPSSFAKIKPAWVRADHGAELTFMFGGPFLTDESSMLA
FPEATEEEQQLSLTMMAQWTTFAWTGDPNGKGLPLWPPFNHEEKYLEISLVPRVNQKPRE
ARMQLWAEILPTKFGQLQQKQKGRKVQEEL
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgggcacagtggtgagaactgggtccggggtcctggtctgggtagcctgtctgctcctg
gcattctctggtacagacactggggcgggggtcactcagcctgaagtggacacactcctg
ggccgtgtgcgaggccggcaggtgggcgtgaagggcacagaccgtcttgtgaacgtcttc
ttgggcatcccattcgcccagccacccctggggccccaccggttctccgccccaggccca
gcggagtcttgggaaggtgtgcgagatgccagtagggcccacgccatgtgcctgcaggat
ctggagagaatgaacaacagcagatttacgctagacggaaagcaccagaccttccccatt
tcggaggactgcctgatcctcaacatatacagcccggctgaggccccctcgggggcagga
aggccagtcatggtgtggttccacgggggctctctcgtgactggcaccgccacctcccac
gatggttctgccctggccgcctacggggacgtggtcgtggtcacagcccagtaccgcctg
ggcttccttggctttttcagcactggggacaagcatgctcctggcaactggggcttcctc
gacgccgtggctgctctgcgctgggtgcagggaaacatcaccccctttgggggtgacttc
aactctgtcaccatctttggtgaatccagcggggcctctgtcgtctctgccctggtcctg
tcccctctggctgcagggctgttccacagagctatagcacagagtggaatcatcaccgta
ccggggttactggatcctgacccctggctcctggctcagtccctcgcagactccttggcc
tgcaactctgactcctcggctgagatggtgcagtgccttcggcagaagacaagcgaggag
atgatcctcgcctacaagtcgaaaaaaatagcttcgtacaacatcgatggcaccttcttt
cccaagagcgctgaggagctcctgagggagaggcagttcccctctgtgcccttcctcttc
ggtgtcaacaaccacgagtttggctggctcatccccaggggctggggtttcctggataag
atggatcaactgagcctggaggacatgctggccatcctgaggccctacttgaccaatatg
gatgtgcccactgaggtgatgcccaccatcataaaggaatacctaggcagcaggtcagat
ggacaagccaagcgagaagccttccaggaattgataagtgacattatcataatcttcccc
atgttgcaatttgcaagagacctccaagattctggggtctccatcttcttctatgagttc
cagcatcgacccagttcttttgcgaagatcaagccagcctgggtgcgggctgatcatggg
gctgagttgaccttcatgttcggcggtcctttcctcacggatgagagctccatgttggcc
tttccagaagccacggaggaggagcagcaactgagcctcaccatgatggcccagtggacc
acctttgcctggacaggggaccccaatggcaaggggctgcctctttggccaccattcaac
catgaggagaaatacctggaaatcagcctggtgccacgggtcaaccagaagccaagggag
gcccgaatgcagctctgggcagagatacttcccaccaagttcgggcagttgcagcagaag
cagaagggcaggaaggtccaggaggaactctga

DBGET integrated database retrieval system