KEGG   Pantholops hodgsonii (chiru): 102329227Help
Entry
102329227         CDS       T02909                                 

Gene name
SCD5
Definition
(RefSeq) stearoyl-CoA desaturase 5
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd01040  Biosynthesis of unsaturated fatty acids
phd01212  Fatty acid metabolism
phd03320  PPAR signaling pathway
phd04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:phd00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    102329227 (SCD5)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    102329227 (SCD5)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102329227 (SCD5)
Enzymes [BR:phd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     102329227 (SCD5)
Lipid biosynthesis proteins [BR:phd01004]
 Desaturase
  First
   102329227 (SCD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 102329227
NCBI-ProteinID: XP_005960208
Position
Un
AA seq 313 aa AA seqDB search
MEAKETIDSLSFVGRAWTVIRTLKKVTQGEKTTQGRELKEVGSTGAILKAVNQNPILQLP
PYFCFLLTALGVTAGAHRLWSHRSYKAKLPLRIFLAAANSMAFQNDIFEWSRDHRVHHKY
SETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDVTDLLADPVVRFQRKYYKITVV
LMCFVVPTLVPWYIWGESLWNSYFLASILRYTISLNVTWLVNSVAHMYGNRPYDKHISPR
QNPLVTLGAIGEGFHNYHHTFPFDYSASEFGLNFNPTTWFIDFMCWLGLATDRKRATKQM
IEARKARTGDGSA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaagccaaagagaccatagattctctctcttttgtcggtagagcgtggactgtgatc
cgaacactgaagaaagttactcaaggggagaagactacacaaggccgtgaattgaaggag
gtaggcagcactggcgccatcttgaaggctgtgaaccaaaaccctatcctgcaacttcct
ccctacttctgcttcctcctgactgctctgggtgtgacagctggtgcccatcgtttgtgg
agccacaggtcctacaaggccaagctgcccctgaggatatttctggctgctgccaactcc
atggctttccagaacgacatcttcgagtggtcgagggaccaccgagtccatcacaagtac
tcggagacagatgctgacccgcacaatgcccgccggggcttcttcttctcccacatcggc
tggctatttgtccgcaagcatcgggatgtcattgagaaggggaggaagcttgacgtcacc
gacttgctggctgaccccgtggtccggttccagagaaagtactacaagatcaccgtggtg
ctcatgtgcttcgtagtccccacgctggtgccctggtacatctggggagagagcctgtgg
aactcctacttcctggcctccatcctccgctataccatctcactcaatgtcacctggctg
gtcaacagcgtcgcccacatgtacggaaacaggccctatgacaagcacatcagtcctcgg
cagaacccgctcgtcaccctgggtgccatcggtgaaggtttccataactaccatcacacc
tttccctttgactactctgcgagtgaatttggcttaaatttcaacccaaccacctggttc
attgacttcatgtgttggctggggctagccactgaccgcaaacgggcaaccaagcagatg
atcgaagcccggaaagcccggactggagacgggagcgcctga

DBGET integrated database retrieval system