KEGG   Pantholops hodgsonii (chiru): 102329449Help
Entry
102329449         CDS       T02909                                 

Gene name
UGT2B4
Definition
(RefSeq) UDP glucuronosyltransferase 2 family, polypeptide B4
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd00040  Pentose and glucuronate interconversions
phd00053  Ascorbate and aldarate metabolism
phd00140  Steroid hormone biosynthesis
phd00830  Retinol metabolism
phd00860  Porphyrin and chlorophyll metabolism
phd00980  Metabolism of xenobiotics by cytochrome P450
phd00982  Drug metabolism - cytochrome P450
phd00983  Drug metabolism - other enzymes
phd01100  Metabolic pathways
phd05204  Chemical carcinogenesis
Module
phd_M00014  Glucuronate pathway (uronate pathway)
phd_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:phd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102329449 (UGT2B4)
   00053 Ascorbate and aldarate metabolism
    102329449 (UGT2B4)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102329449 (UGT2B4)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102329449 (UGT2B4)
   00860 Porphyrin and chlorophyll metabolism
    102329449 (UGT2B4)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102329449 (UGT2B4)
   00982 Drug metabolism - cytochrome P450
    102329449 (UGT2B4)
   00983 Drug metabolism - other enzymes
    102329449 (UGT2B4)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    102329449 (UGT2B4)
Enzymes [BR:phd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102329449 (UGT2B4)
Glycosyltransferases [BR:phd01003]
 Others
  Hydrophobic molecule
   102329449 (UGT2B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C DUF276 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 102329449
NCBI-ProteinID: XP_005957884
Position
Un
AA seq 532 aa AA seqDB search
MNKMSLKWLSLLLLLQLACYFSSGSCGKVLVWPMDYSHWMNMKTILDELVTRSHEVTVLT
PSVSTFIDPKKTSSLKLVTFPLSLIKEENENFLKLFVEKWKHAVRDSFWNHLSTVESLSW
GYSDILMKTCREVVSNKELMVKLHEERFDVIFADAVGPCGELLAEILKIPFMYSLYSTPG
SSVEKKSGRLPFPPSYVPVMLSELSDHMTFMERVKNMIYALYFEFWFQAYNEKKWNQFYS
EVLGRPTTLVETMGKAEMWLIRNYWDFSFPRPRLPNFEFVGGIHCKPAKSLPKEMEEFVQ
SSGEHGIAVFSLGSMVSNMSEERANVIASALAQIPQKVLWRYDGKKPDTLGPNTQLYKWL
PQNDLLGHPKTKAFVTHGGSNGIYEAIYHGIPMVGLPLFADQPHNIVHMKAKGAAVRLDL
ETMSTEDFLSALKEVINNPSYKQNVMKLSAIHHDRPVKPLDLAVFWIEFVMRHKGAKHLR
PAIHNLTWLQYHSLDVIGFLLACVATAAFVITKCCLFCYRKFAGKGRKGKRD
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatgtctttgaaatggctctcacttctgttgctgctacaattggcttgctac
tttagttctggaagttgcggaaaggtgctggtgtggccaatggactatagtcattggatg
aatatgaagacaattctggatgaacttgtcacaaggagtcatgaggtgactgttttgaca
ccttcagtttccactttcattgatcccaaaaaaacatcttctctcaaattagtgactttc
cctctatctttaattaaagaagaaaatgagaattttctcaaactttttgttgagaaatgg
aagcatgcagtgagagactccttttggaaccatctttcaacagtggaaagtttatcttgg
ggatattctgatattttaatgaagacttgcagagaagttgtttcaaacaaggaacttatg
gtaaaactgcatgaagaaaggtttgatgtcatttttgcagatgctgttggaccctgtggt
gagctgctggctgagatacttaaaataccattcatgtacagtctctactccacacctgga
tcttcagttgaaaagaagagtggaaggcttccattcccaccatcctatgtacctgttatg
ctgtcagaattaagtgatcacatgacattcatggagagggtcaaaaatatgatatatgca
ctctattttgaattctggttccaggcatacaatgagaagaagtggaatcagttttacagt
gaagtactaggaaggcccactacgttagttgagacaatggggaaagctgaaatgtggctc
attcgaaactattgggatttttcatttcctcgcccaaggctaccaaattttgaatttgtt
ggaggcatccactgcaaacctgccaaatctctgcctaaggaaatggaagagtttgtgcag
agctctggagaacatggcattgcggtgttttcattggggtcgatggtcagtaacatgtca
gaagaaagagccaatgtgattgcttcagctcttgcccagattccacaaaaggttctatgg
agatatgatggcaaaaaaccagacaccctaggacccaatactcagctgtataagtggctc
ccccaaaacgaccttcttggtcatccaaaaaccaaagcctttgtaactcatggtggaagc
aacggcatttatgaggccatctaccatgggatccctatggtgggccttcctttgttcgct
gatcaacctcataacattgttcacatgaaggccaagggagctgctgtcagattggacttg
gaaacaatgtcaacagaagattttctcagtgcattgaaggaagtcattaataatccttcc
tacaaacagaatgtgatgaagttatcagccattcatcatgatcggcctgtaaagccccta
gacctagcagtcttctggattgagttcgtcatgcgccacaaaggagccaagcacctgcga
ccagctatccacaacctcacctggctccagtaccactctctggacgtgattgggtttctg
ctagcctgtgtagcaactgctgcatttgtcatcacaaagtgttgcctgttttgttaccgg
aagtttgctggcaaaggaaggaaggggaaaagagactag

DBGET integrated database retrieval system