KEGG   Pantholops hodgsonii (chiru): 102329470Help
Entry
102329470         CDS       T02909                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
Glycerolipid metabolism
Metabolic pathways
Thermogenesis
Retrograde endocannabinoid signaling
Regulation of lipolysis in adipocytes
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:phd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102329470 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102329470 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    102329470 (MGLL)
  Environmental adaptation
   04714 Thermogenesis
    102329470 (MGLL)
Enzymes [BR:phd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102329470 (MGLL)
Peptidases [BR:phd01002]
 Serine Peptidases
  Family S33
   102329470 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 384 aa AA seqDB search
MPEESSPRLTPQNVPYRDLPHLVNADGQHLFCRYWKPSGTPRALVFVSHGAGEHCGRYEE
LAQMLVGLGLLVFAHDHVGHGQSEGERMVVSDFHVFIRDALQHVDAVQKDHPGLPVFLLG
HSMGGAICILTAAERPGHFSGMVLISPLGVASPDSAALFKVFAAKVLNLVLPNMSLGRID
SSVLSRNKTEVDIYNSDPLVCRAGLKVCFGIQLLNAVSRVERALPKLTLPFLLLQGSADR
LCDSRGAYLLMESAKSQDKTLKIYEGAYHILHKELPEVTSSVFREINTWVSQRTAGAGFS
DMAETHTHTPHRLEGSLAQLTQTVLSPVRLSTTGSALNGGRFMQKLELMALSREPHNRPL
LRLMRKRVTMAGRFQSRMPGRHVV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggaaagttcccccaggctgaccccacagaacgttccctaccgggacctccct
cacctggtcaacgctgacggacagcacctcttctgccggtactggaaaccctcaggcacg
cccagggcgctggtgtttgtgtcccacggggccggcgagcactgcggccgctacgaggag
ctggcgcagatgctggtggggctgggcctgctggtcttcgcccacgaccacgtcggccat
gggcagagtgaaggcgagaggatggtggtgtccgacttccatgtcttcatccgggacgcg
ctgcagcatgtggacgccgtgcagaaggaccacccggggctgcctgtcttccttctgggc
cactccatgggcggcgcaatctgcatcctcacagccgcggagcggccgggccacttctcg
ggcatggtcctcatctccccgctgggcgtcgccagcccagactcggcggcacttttcaag
gtctttgctgcgaaagttctgaacctcgtcctgccaaacatgtccctgggccggatcgac
tccagtgtgctctcgaggaataagacagaggtggacatctacaactcggaccccttggtc
tgccgggctgggctcaaagtctgcttcggcatccagctgctcaacgcggtgtctcgggtg
gagcgggcgctgcccaagctgacgctgcctttcctgctgctccagggctccgccgaccgc
ctctgcgacagcaggggtgcctacctgctcatggagtcggccaagagccaggacaagact
ctcaagatttacgaaggtgcctaccacatcctccacaaagagcttcctgaggtgaccagc
tccgtcttccgggagataaacacgtgggtctcgcaaaggacagcaggggctggcttctca
gacatggctgagacacacacacacacaccccacagattggagggatccctagcacagctg
actcagacagtcttgtcacctgtcaggctgtccaccactggatctgccttaaacggtgga
cgctttatgcaaaaactggagctcatggcactttccagagaaccccacaaccggccactg
ctgcgcctcatgcggaaacgtgtcaccatggcgggccgcttccaaagccgaatgccgggc
aggcacgtggtctga

DBGET integrated database retrieval system