KEGG   Pantholops hodgsonii (chiru): 102332226Help
Entry
102332226         CDS       T02909                                 

Definition
ribonuclease pancreatic-like
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
phd  Pantholops hodgsonii (chiru)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 146 aa AA seqDB search
MALKSMVLLSLLALVGVQPSLGKESAAAKFERQHMDSSTSSASSSNYCNQMMKSRSLTQG
RCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYK
TTQAKKHIIVACEGNPYVPVHFDASV
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaagtccatggtcctgttgtcactgttggccctggtgggggtccagccttcc
ctgggcaaggaatctgcagccgccaagtttgagcggcagcacatggattccagcacttcc
tctgccagcagctccaactactgcaaccagatgatgaagagccggagcctgacccaaggt
cgatgcaagccagtgaacaccttcgtgcatgagtccctggccgatgtccaggccgtgtgc
tcccagaaaaatgttgcctgcaagaatgggcagaccaattgctaccagagctactccacc
atgagcatcacagactgccgtgagaccggcagctccaagtaccccaactgtgcctacaag
accacccaggcaaagaaacacatcatagtggcctgtgaggggaacccatacgtgccagtc
cacttcgatgcttcagtgtag

DBGET integrated database retrieval system