KEGG   Pantholops hodgsonii (chiru): 102332820Help
Entry
102332820         CDS       T02909                                 

Definition
brain ribonuclease-like
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
phd  Pantholops hodgsonii (chiru)
Brite
Enzymes [BR:phd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     102332820
Messenger RNA biogenesis [BR:phd03019]
 Eukaryotic Type
  mRNA degradation factors
   Other degradation factors
    RNases
     102332820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 170 aa AA seqDB search
MALKSLVLLSLLALVLLLLVQVQPSLGKESAAAKFRRQHMDSGSSSSGNSNYCNQMMKRR
RMTHGRCKPVNTFVHESLDDVKAVCSQKNITCKNGQPNCYQSNSTMNITDCRETGSSKYP
NCAYKTSQKQKYIIVACEGNPYVPVHFDGAVLLAATPLPSLPPPHKQRLL
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaagtccctggtcctgttgtcactgttggccctggtgctgctgctgctggtg
caggtccagccttccctgggcaaggaatctgcagccgccaagttccggaggcagcacatg
gactctggcagctcctccagtggcaactccaactactgcaatcagatgatgaagcgccgg
aggatgacacatggacgatgcaagccagtgaacacctttgtgcatgagtccctggatgat
gtcaaggccgtgtgctcccagaaaaacatcacctgcaagaatgggcagcccaactgctac
cagagcaactccaccatgaacatcacagactgccgcgagacaggcagctctaagtacccc
aactgtgcctacaagactagccagaagcagaaatatatcattgtggcttgtgagggaaac
ccatacgtaccagtccactttgatggtgcggtgctcctagctgccacacccctaccctca
ctgccacctccacacaagcaaaggcttctctga

DBGET integrated database retrieval system