KEGG   Pantholops hodgsonii (chiru): 102333383Help
Entry
102333383         CDS       T02909                                 

Gene name
TGM7
Definition
transglutaminase 7
Orthology
K05623  
transglutaminase 7 [EC:2.3.2.13]
Organism
phd  Pantholops hodgsonii (chiru)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 708 aa AA seqDB search
MDEVAALELRSVDLQSAKNNQEHHTQEMGLQRLIVRRSQSFTIQLHFNRPFHSKKDSITF
VAETAPKELLGTRATFLLTQARQGSGWSASDFTVHANSLYVSLFTPPSAVIGPYSLKIEI
SQGPSHSTTHPLGTFILLFNPWSAEDDVYLPSETLLQEYIMMDYGFVYKGHERFITPWPW
NYGQFEEDIIDICFEILNKSLYFLKNPSKDYSQRNDVVYICRVVSAMINSNDDSGVLQGN
WGEDYSRGVSPLEWTGSVAILRQWAARGGQPVKYGQCWVFAAVMCTVMRCLGVPTRVVSN
FRSAHNSDANLTIDTYYDQHAEMLPTQKRDKIWNFHVWNECWMIRKDLPPGYNGWQVLDP
TPQQISSGLFRCGPASVKAIREGEIHLPYDTPFVYAEVNADEVVWLLKDGQAQEILAHNT
SSIGKEISTKMVGSDQRENITSSYKYPEGSPEERSVFMKASQKMLGVRRTSSPFLDLLGS
GGDVGQPAQLQLHLTRKPEWGQDLLLKLHARRVADRAHPQGPIHLVVDFCAQTLLHNGGT
RKPLWRQKVHLTLDFGEDIQWPLSLPYNNYRNKLTDEKLIRVSGIAKVEETGRSMLVLKD
ISLEPPHLSIEVSERAEVGKALRVHISLTNTLSVALSHCTMVLEGSGLVSGQISNDLGTL
VAGHTIKIQVDLYPIKAGPRQLQVLVSSNEIKEIKGYKDIFVAAARAP
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggatgaggtggcagccttggagctcaggtctgtcgacctgcagagcgccaagaacaac
caggagcatcacacacaggagatgggcctccagcggctcatcgtgcgccgtagccagtcc
ttcaccatccagctgcatttcaaccgccccttccactcgaagaaggactccatcaccttt
gtggctgagacagcacccaaggagctgctgggaacccgagccaccttcttgctcacccaa
gcccgacaaggcagtggctggagtgcttctgacttcaccgttcatgccaactcgctctat
gtctccctttttacaccgcccagtgcagtcattggtccctactctctgaagatagagatc
tctcagggcccaagtcatagcacgacccaccctctggggaccttcatcctactttttaac
ccttggagtgcagaggacgacgtctacctgccaagtgaaacgctgctgcaggagtatatc
atgatggactatggctttgtttacaagggtcatgaaagattcatcaccccctggccctgg
aactacgggcagtttgaagaggacatcatagatatctgctttgagattctgaacaagagc
ctgtacttcttaaagaacccgtccaaagactactcgcagcggaacgacgtggtgtacatc
tgcagggtggtgagcgccatgatcaacagcaacgacgacagcggcgtgctgcaggggaac
tggggagaggactactcccggggggtcagccctctggagtggacgggcagcgtggccatc
ctgcggcagtgggcggccaggggcgggcagcctgtgaagtatgggcagtgctgggtcttt
gcagctgtgatgtgtacggtaatgagatgcttaggtgttccaacacgtgttgtttccaat
ttccgttctgcacacaactcggatgcaaacttgaccatcgacacctactatgaccaacac
gcagagatgctgccaactcagaagcgagacaaaatatggaatttccatgtctggaatgag
tgctggatgatccggaaagacctccctccaggatacaacgggtggcaggttctggacccc
actccccagcaaatcagcagcgggctgtttcgctgtggccctgcctccgtgaaggccatc
agggaaggggagatccacctgccttacgataccccatttgtgtatgccgaggtgaacgct
gatgaagtcgtttggctattgaaggatggccaggcccaggaaatcctggcccataacacc
agttccatcgggaaggaaatcagcaccaagatggtagggtcagaccagcgcgagaacatc
accagctcctacaagtacccagaaggatcccctgaggagcgatctgtgtttatgaaggcc
tcccagaaaatgctgggtgtacggaggacctcttcaccattcctagatcttttggggtct
gggggtgatgtgggccagccggcacagctgcagcttcacctgaccaggaagcctgagtgg
ggccaggacctgctgctgaagctgcatgcccggagggtggcagacagagcccacccccag
gggcccatccacctggtggtggacttctgtgcacagactctgctgcacaacggtggtacc
cggaagcccctctggagacagaaagtgcacttgaccctggactttggggaggatatacag
tggcctctctcgctaccttacaacaattacagaaacaagctgacagatgaaaagctgatc
cgtgtgtctggcatcgccaaagtggaggagacagggaggtccatgctggttttaaaagat
atctccctggagcctccccacttatctattgaggtgtctgagagggctgaggtgggcaag
gcactgagagttcacatctcgctcaccaacaccctctcagtggctctgagtcactgcaca
atggtgctggagggcagtggcctcgtcagtgggcagatatcaaatgaccttgggactctg
gtggccggacacactatcaaaattcaagtggacctctaccccatcaaagccggaccccgc
cagctccaagtcctcgtcagcagcaacgagatcaaagagatcaagggatacaaggacatc
tttgttgctgcagccagggctccttga

DBGET integrated database retrieval system