KEGG   Pantholops hodgsonii (chiru): 102333530Help
Entry
102333530         CDS       T02909                                 

Gene name
RNASE2
Definition
ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin)
Organism
phd  Pantholops hodgsonii (chiru)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 158 aa AA seqDB search
MVPIQQESRLCRILLLGLLGMVISLHAPPGTLTWAQWFEIQHINMAHPQCNAAMLVVNRY
RMVCKDKNTFLHKTFAYVAGICNTPNVNCSKQGKMNCHNISVQVPITCCNLTRNALNYTN
CSYQQTSAQKIFIIACENRSSRDSPRYPVVPVHLDKII
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggttcccatacagcaggagtctcggctttgtcgcattttgctgctggggctcttggga
atggtgatctcactccatgccccacctggtactttaacctgggctcagtggtttgagatt
cagcacataaatatggcccaccctcaatgcaatgccgcaatgctagtggttaaccgttac
agaatggtatgtaaagataaaaatacttttctccacaaaacatttgcttatgtagctggt
atttgtaacaccccaaatgtaaactgctctaaacaaggcaagatgaactgtcataatatc
tcagtccaagtgcctataacctgctgcaacctcacaagaaatgcattgaactacaccaac
tgcagttaccaacagacatcggcacagaagatcttcatcatcgcctgtgagaacagatca
tcccgggacagtcccaggtatcctgtggttccagttcacttggataagatcatctag

DBGET integrated database retrieval system