KEGG   Pantholops hodgsonii (chiru): 102334395Help
Entry
102334395         CDS       T02909                                 

Gene name
ST6GAL1
Definition
ST6 beta-galactosamide alpha-2,6-sialyltranferase 1
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:phd00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    102334395 (ST6GAL1)
   00514 Other types of O-glycan biosynthesis
    102334395 (ST6GAL1)
Enzymes [BR:phd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     102334395 (ST6GAL1)
Glycosyltransferases [BR:phd01003]
 Terminal extension
  Sialyltransferase
   102334395 (ST6GAL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 414 aa AA seqDB search
MVSLNTPFIMTRTSLKKKCFSCCVLIFLLFAIICVWKEKKKGNYYEFLKLQNKEYQMLQG
LEKLAMSSSSQPVSSSSTHNPQKNIQALGGPKAKLGATFQVWDKDSSSKNLAPRLQTIRK
NYLNMNKYKVTYKGPGPGVKFSAEALLCHLRDHVNISMIEATDFPFNTSDWEGYLPQEDI
RTKAGPWGRCAVVSSAGSLKSSRLGREIDDHDAVLRFNGAPTVKFQQDVGTKTTIRLVNS
QLVTTEAGFLKDSLYNEGILIVWDPSVYHSDIPKWYRNPDYSFFNNFKSYRKLHPDQPFY
ILKPQMPWELWDIIQEISSELIQPNPPSSGMLGIAIMMSLCDQVDIYEFLPSKRKTDVCY
YYQRYFDSACTMGAYHPLLFEKNMVKHLNLGTDEDIYLLGKATLPGFRTIRCGA
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggtttccttgaacacgcctttcattatgactcgcaccagcctgaagaaaaaatgcttc
agctgctgtgtgctcatctttctcctgtttgccatcatctgtgtgtggaaggaaaagaag
aaagggaattactatgagttccttaaactgcagaacaaggaataccagatgttgcagggc
ctggagaaactggccatgagctctagttcccaacctgtgtcctccagcagcacccacaac
ccccagaagaacatccaggcactcggtggtcccaaggccaagttgggggctaccttccag
gtttgggacaaggacagctcctccaaaaaccttgcccccaggctgcaaactatccggaag
aattatctgaacatgaacaagtacaaagtgacgtacaaggggccagggcctggggtcaag
ttcagtgcagaggccctgctttgccacctgcgggaccacgtcaacatttcaatgatagag
gccacagattttcccttcaacacctctgactgggagggctacctgcctcaggaggacatt
aggaccaaggccgggccgtggggcaggtgtgctgtggtctcttcagcaggatctctgaag
tcctcccggctgggtcgagaaatagatgatcacgatgcagtcctgaggtttaatggggca
cccacagtcaaattccaacaagacgtgggcacgaaaaccaccattcgtctggtaaactct
cagttggtcaccacggaagcgggcttcctcaaagacagtttgtacaatgaaggaatccta
attgtgtgggacccatctgtttaccattcagatatcccaaagtggtacagaaatcctgac
tacagtttcttcaataacttcaagagctatcgtaagctgcatcctgatcagcccttttac
atcctcaagccccagatgccttgggagctgtgggacatcattcaagaaatctcctcagag
ctgatccagccaaatcccccatcctctgggatgctcggcattgccattatgatgtcactg
tgtgaccaagtggatatttacgagttcctcccatccaagcgcaagactgatgtgtgctac
tactatcagaggtatttcgacagtgcctgcacaatgggcgcctaccacccactcctcttt
gagaagaacatggtgaagcacctcaacctcggcacagatgaggacatctacctgcttgga
aaagctacactgcctggcttccggacaattcgctgcggagcataa

DBGET integrated database retrieval system