KEGG   Pantholops hodgsonii (chiru): 102334558Help
Entry
102334558         CDS       T02909                                 

Definition
lysozyme C, milk isozyme-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:phd00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    102334558
Enzymes [BR:phd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     102334558
Exosome [BR:phd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102334558
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 168 aa AA seqDB search
MLNTKSSSPWAPWTSGLSVNMKTLLILGLLLLSVAVQGKKFQRCELARTLKRLGLDGYKG
VSLANWMCLARWESNYNTQATNYNRGDKSTDYGIFQINSRWWCNDGKTPKAVNACRIPCS
ALLKDDITQAVACAKRVVSDPQGIRAWVAWRNKCQNKDLRSYVKGCGV
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgttaaataccaagtccagctcaccctgggcaccctggacttctggcttgtcagtcaac
atgaagactctccttattctggggcttctcctcctttctgttgctgtccagggcaagaaa
tttcagaggtgtgagcttgccagaactctgaaaagacttggattggatggctataaggga
gtcagcctggcaaactggatgtgtttggccagatgggaaagcaattacaacacacaagct
acaaactacaatcgtggagacaaaagcactgattatgggatatttcaaatcaatagccgc
tggtggtgcaatgatggcaaaaccccaaaagcagttaacgcctgtcgtataccctgcagc
gctttgctgaaagatgacatcactcaagctgtagcatgtgcaaagagggttgtcagtgat
ccacaaggcattagagcatgggtggcatggagaaacaagtgtcaaaacaaagatctcagg
agttatgttaagggttgcggagtgtaa

DBGET integrated database retrieval system