KEGG   Pantholops hodgsonii (chiru): 102334699Help
Entry
102334699         CDS       T02909                                 

Gene name
CREBBP
Definition
CREB binding protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
HIF-1 signaling pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Long-term potentiation
Melanogenesis
Thyroid hormone signaling pathway
Huntington's disease
Tuberculosis
Hepatitis B
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
MicroRNAs in cancer
Renal cell carcinoma
Prostate cancer
Brite
KEGG Orthology (KO) [BR:phd00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    102334699 (CREBBP)
   04330 Notch signaling pathway
    102334699 (CREBBP)
   04350 TGF-beta signaling pathway
    102334699 (CREBBP)
   04630 Jak-STAT signaling pathway
    102334699 (CREBBP)
   04066 HIF-1 signaling pathway
    102334699 (CREBBP)
   04068 FoxO signaling pathway
    102334699 (CREBBP)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    102334699 (CREBBP)
  Cell communication
   04520 Adherens junction
    102334699 (CREBBP)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102334699 (CREBBP)
   04916 Melanogenesis
    102334699 (CREBBP)
  Nervous system
   04720 Long-term potentiation
    102334699 (CREBBP)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102334699 (CREBBP)
   05206 MicroRNAs in cancer
    102334699 (CREBBP)
   05203 Viral carcinogenesis
    102334699 (CREBBP)
   05211 Renal cell carcinoma
    102334699 (CREBBP)
   05215 Prostate cancer
    102334699 (CREBBP)
  Neurodegenerative diseases
   05016 Huntington's disease
    102334699 (CREBBP)
  Infectious diseases
   05152 Tuberculosis
    102334699 (CREBBP)
   05166 HTLV-I infection
    102334699 (CREBBP)
   05164 Influenza A
    102334699 (CREBBP)
   05161 Hepatitis B
    102334699 (CREBBP)
   05168 Herpes simplex infection
    102334699 (CREBBP)
   05169 Epstein-Barr virus infection
    102334699 (CREBBP)
Enzymes [BR:phd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102334699 (CREBBP)
Transcription factors [BR:phd03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    102334699 (CREBBP)
Mitochondrial biogenesis [BR:phd03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102334699 (CREBBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2178 aa AA seqDB search
MGPEWGGTCPVRLDRPELESPPRRETEWYFQGGKVKWSVCILRGDSVCLPLPPWTDTSVA
GWRDDSGGLSFALSWAHPVLTWCRDMNFLGLEVVVLNLEFLELPMIQTGVCPTYFGTLFD
LENDLPDELIPNGGELSLLNSGNLVPDAASKHKQLSELLRGGSSSSINPGIGNVSASSPA
QQGLGGQAQGQPSSANMASLGAMGKSPLNQGDSSAPSLPKQAASTSGPTPPASQALNPQA
QKQVGLVTSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGA
AGRGRGAGMPYPTPAMQGATSSVLAETLTQVSPQMASHAGLSTAQAGGMSKMGMTGNTSP
FGQPFSQTGGQQMGAPGVNPQLPSKQSMVNSLPPFATDIKNASVTNVPNMSQMQTSVGIV
PTQAIATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHM
THCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQN
TIGSVGTGQQNATSLSNPNPIDPSSMQRAYAALGLPYLNQPQTQLQPQVPGQQPAQPQTH
QQMRSLNPLGNNPMNIPAGGITTDQQPPNLISESALPTPLGATNPLMNDGSNSGNIGTLS
TIPAAAPPSSTGVRKSWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKK
VEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLHKQGILGNQPALPAPGTQPPGI
PQAQPVRPPNGPMPLPVNRMQVSQGMNSFNPISLGNVQLPQAPMGPRAASPMNHSVPMNS
MGSVPGMAISPSRMPQPPNMMGAHANSMMAQAPAQSQFLPQSQFPSSSGALSVSSVGMGQ
PAAQAGVPQGQVPGAALPNPLNMLGPQASQLPCPPVXXXXXXXXXXPASTAAGMPSLQHP
AAPGVTPPQPAAPTQPSTPASSSGQTPTPTPGSVPSASQTQSTPTVQAAAQAQVTPQPQT
PVQPPSVATPQSSQQQPTPVHTQPPGTPLSQTAASIDNRVPTPSSVASAETNSQQPGPEV
PLLEMKAEIKTEDTEPDAGEPKGEPGAAMMEEDLQGSSQVKEETDPTEQKSEPMEVDEKK
TEVKVEAKEEEEGSTNGTASQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFR
QPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTS
RVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQN
RYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQ
ICVLHYDIIWPSGFVCDNCLKKTGRTRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHP
EAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGM
HVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIW
ACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDILKQATEDRLT
SAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKK
TNKNKSSISRANKKKPSMPSVSSDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDP
DPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNERKH
HVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLDDEGGSQGEPQSKSPQESRRLSI
QRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKH
CQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGT
PTQQPSTPQTPQPPAQPQPSPVSMSRLGQMGQPGLGADSTPNIQQALQQRILQQQQMKQQ
MGSPGQPNPMSPQQHMLSGQPQASHLPGQQMATSLSSQVRSPAPVQSPRPQSQPPHSSPS
PRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHLGNPEQSAMLPQLNTPNRSALSSEL
SLVGDTTGDTLEKFVEGL
NT seq 6537 nt NT seq  +upstreamnt  +downstreamnt
atggggcccgagtggggcggcacatgcccggtgcgcttggatcgcccggagctggagagc
cctcctcgccgggagaccgagtggtactttcagggaggaaaagtaaagtggagcgtgtgt
attctgcgtggtgattccgtctgcctcccactgccgccgtggacggacacaagcgtggct
ggctggagggatgacagcggaggcctcagctttgccctctcctgggcccatcccgtgctg
acgtggtgtagagacatgaacttcctgggattggaagtggtggtgctcaatcttgaattt
ttggaacttccgatgattcagactggtgtttgcccaacctattttggaacattgtttgac
ttggaaaatgatcttcccgatgagttgatccccaatggaggagaattaagccttttaaac
agtgggaacctcgttccagatgctgcttccaaacataaacaactgtccgagctcctgcga
ggcggcagcagctccagcatcaacccgggaataggcaatgtgagtgccagcagccccgcg
caacaaggcctcggcggccaggcccaggggcagcccagcagtgccaacatggccagtctg
ggtgccatgggcaagagccctctgaaccagggagattcttcggcccccagcctgcccaag
caggcagccagcacctccgggcccactcctcctgcttcccaagcactgaatccgcaagca
caaaagcaagtggggctggtaaccagcagccctgccacgtcgcagacgggacctgggatc
tgcatgaacgcaaacttcaaccagacccacccaggcctcctcaatagtaactctggccac
agtttaatgaaccaggcccagcaaggacaggcgcaggtcatgaatggatctctcggggct
gctggccgaggaaggggagctgggatgccataccctactccggccatgcagggggccacg
agcagtgtgctggctgagacgttgacccaagtttcaccgcaaatggccagtcacgcgggg
ctgagcaccgcacaggccggaggcatgagcaagatgggaatgactggtaacacaagtcca
tttggacaaccctttagtcaaactggagggcagcagatgggagcccctggagtgaacccc
cagctgccgagcaagcagagcatggtcaacagcttgcctccctttgccacagacatcaag
aacgcttcagtcaccaacgtgccaaacatgtctcagatgcaaacatcagtgggaattgta
cccacacaggcaattgcaacgggccccactgcagatcctgaaaaacgcaaactgatacag
cagcagctggtcctactgcttcacgctcataaatgtcagaggcgagaacaagccaacgga
gaggtccgggcctgctcactcccacattgtcgaaccatgaaaaacgtcttgaatcacatg
acgcattgtcaggctgggaaggcttgtcaagttgcccattgtgcatcttcacgacaaatc
atctctcattggaagaactgcacacgacatgactgtcctgtttgcctccctttgaaaaat
gccagtgacaagcgaaaccaacaaaccatcctggggtctccagctagtggaattcaaaac
accattggttctgttggcaccggccaacagaatgccacttctttaagtaacccaaatccg
atagaccccagctccatgcaacgagcgtatgctgctcttggactcccctacctgaaccag
ccccagacgcagctgcagcctcaggttcctggccagcaaccagcacagcctcaaactcac
cagcagatgaggagtctcaaccccctgggaaataacccaatgaacattccagcaggagga
ataacaacagatcagcagccaccaaacttgatttcagaatcagctcttccaactcccctt
ggggctacaaaccccctgatgaatgatggctcaaactctgggaacattggcaccctcagc
actatacctgcagcagcacctccttccagcactggcgttcggaaaagctggcatgaacac
gtcactcaggacctgcggagccatctagtgcataaacttgtccaagccatcttcccgaca
cctgaccctgcagccctgaaggatcgccgcatggagaacctggtggcctatgctaagaaa
gtggaaggggacatgtacgagtctgccaacagcagggatgaatactatcacttactagca
gagaaaatctacaagattcaaaaagagctagaagaaaagcggagatcgcgtttacacaaa
caaggcatcttgggtaaccagccagccttaccagcccctgggacacagccccctggaata
ccccaggcgcagcctgtgagacctccaaatgggcccatgcctctgccagtgaatcgtatg
caggtttctcaagggatgaattcatttaacccaatatccttggggaacgtacagttgcca
caagcgcccatgggaccgcgtgcggcatcccccatgaaccactctgtcccgatgaacagc
atgggctctgttccagggatggccatttctccgtcccgaatgcctcagcctccgaacatg
atgggtgcgcacgccaacagcatgatggcccaggcgcctgcgcagagccagttcctccca
cagagccagttcccatcgtcgagcggggcgctgagtgtgagcagcgtgggcatggggcag
ccagcggcgcaggctggcgttccacaggggcaggtgccaggggctgctcttcccaacccc
ttgaacatgcttgggccccaggccagccagctgccttgcccaccagtnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnntcccgcctccacggccgctggcatgccgtctctgcagcaccca
gcagctcccggggtgacacccccccagccagcagcgcctacccagccatcaactcccgcg
tcatcttccgggcagactcccaccccgactcccggctccgtgcccagcgccagccagacg
cagagtactcctacggtccaggcagccgcccaggcccaggtgaccccgcagcctcagacc
ccagtccagcctccgtcggtggctaccccgcagtcatcgcagcagcagccgacacccgtg
cacacgcagccccctggcaccccgctttcccagacagcagccagcattgataacagggtc
cccactccatcctcagtggccagcgccgaaaccaactcccagcagccaggccccgaggtg
ccactgctggagatgaaggccgagatcaagactgaggacacagagcccgatgctggggag
cccaagggagagcccggggctgcgatgatggaggaggacttacaaggatcttctcaagtt
aaagaagaaacagacccaacagagcagaagtcagaaccaatggaagtggatgaaaagaaa
actgaagtgaaggttgaagctaaagaggaagaagagggcagcaccaatggcacagcctct
cagtccacgtccccttcacagcctcgcaagaaaatcttcaagccggaggagttgcgccag
gctctgatgccaaccctggaagccctgtaccgacaggatccagagtccttaccttttcgg
cagcctgtggatccccagctcctgggaattccagattactttgacattgtgaagaatccc
atggacctttccaccatcaagcggaagctggatacagggcagtaccaggagccctggcag
tatgtagacgacgtctggctcatgttcaacaatgcctggctctacaatcggaagacatcc
cgggtctacaagttctgcagcaaactcgcagaggtctttgagcaggagattgaccccgtc
atgcagtcccttggatattgctgtggacgcaagtatgagttttccccacagactctgtgc
tgctacgggaagcagctgtgtacaattcctcgagatgctgcctactacagctatcagaat
aggtatcacttctgtgagaagtgtttcacagagatccagggggagaatgttaccctgggt
gacgacccttcacaaccccagacgacaatttcaaaggatcagtttgaaaagaagaaaaat
gataccttagatcctgaaccttttgttgactgcaaggagtgtggccggaagatgcatcag
atttgtgttctccactacgacatcatctggccttcaggctttgtatgcgacaactgcttg
aagaaaacgggcagaactcgaaaagaaaacaaattcagtgctaagagactacaaaccaca
cggttgggaaaccacctggaagaccgagtcaacaagtttttgcggcgacagaatcacccc
gaagccggggaggtgtttgtccgtgtggtggccagctcagacaagacggtggaggtcaag
ccagggatgaagtcacggtttgtggattctggggagatgtcggagtctttcccatacaga
accaaagcactctttgcctttgaggagattgatggggtggacgtgtgcttctttgggatg
catgtccaggagtacggctctgactgccccccaccaaacacaaggcgtgtgtatatatct
tatctggatagtattcatttcttccgaccccgatgcctccgaacagccgtttaccatgag
atccttattggatatttagagtatgtgaagaaattggggtatgtgacagggcacatctgg
gcctgtcccccgagtgaaggagatgactacatcttccactgccacccccctgatcaaaaa
atccccaagccaaagcgcctgcaggagtggtataagaagatgctggacaaggccttcgcc
gagcgcatcatccatgactacaaggacattttgaaacaagcaactgaagacaggctcacc
agcgccaaggagctgccctactttgagggggacttctggcctaacgtgctggaggagagc
attaaggagctggagcaggaggaggaggaaagaaagaaggaggagagcaccgcggccagt
gagaccacggagggcagccagggcgacagcaagaacgccaagaaaaagaacaacaagaaa
accaacaagaataagagcagcatcagccgcgccaacaagaagaagcccagcatgcccagc
gtgtccagcgacctgtcccagaaactctacgccaccatggagaagcataaagaggtcttc
tttgtgatccacctccacgctgggcccgtcatcaacacgctgccccccatcgtcgacccc
gaccccctgctcagctgtgacctcatggatgggcgggatgccttcctcacactggcccgg
gacaagcactgggagttctcctccttgcggcgctccaagtggtccacgctgtgcatgctg
gtggagctgcacacccagggtcaggaccgcttcgtctacacctgcaatgagcgcaagcac
cacgtggagacacgctggcactgcaccgtgtgtgaggactatgacctctgcatcaactgc
tacaacacgaagagccacacccataagatggtgaagtgggggctgggcctggacgacgag
ggcggcagccaaggcgagccgcagtccaagagcccccaggagtcgcggcgcctgagcatc
cagcgctgcatccagtcgctggtgcacgcctgccagtgccgcaacgccaactgctcactg
ccgtcctgccagaagatgaagcgggtggtgcagcacaccaagggctgcaagcgcaagacc
aacggcggctgcccggtgtgcaagcagctcatcgccctctgctgctaccatgccaaacac
tgccaagaaaacaagtgccccgtgcccttctgcctcaacatcaaacacaagctccgccag
cagcagatccagcaccgcctgcagcaggcccagctcatgcgccggcggatggccaccatg
aacacccgcaacgtgcctcagcagagcctgccttcccctacctcagcgccgcccgggacc
cccacgcagcagcccagcacgccccagacgccgcagccccccgcccagccccagccctca
cctgtgagcatgtcacgactcggccagatggggcagcctgggctgggcgcagacagcacc
cccaacatccagcaggccctgcagcagcggattctgcagcagcagcagatgaagcagcag
atggggtccccgggccagccgaaccccatgagcccccagcagcacatgctctcaggacag
cctcaggcctcgcacctccccggccagcaaatggccacgtcccttagtagccaggtgcgg
tctccggcccctgtccagtctccgcggccccagtcccagcctccacattccagcccgtcg
ccacggatacagccccagccttcaccgcaccacgtctcgccccagactggttccccccac
ccaggactcgcagtcaccatggccagctccatagatcagggacacttggggaaccccgaa
cagagtgcaatgctcccgcagctgaacacccctaaccggagtgcgttgtccagtgagctg
tccctggtcggcgacaccacgggagacaccctagaaaagtttgtggagggtttgtag

DBGET integrated database retrieval system