KEGG   Pantholops hodgsonii (chiru): 102335205Help
Entry
102335205         CDS       T02909                                 

Gene name
CTRB1
Definition
chymotrypsinogen B1
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
phd  Pantholops hodgsonii (chiru)
Brite
Enzymes [BR:phd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     102335205 (CTRB1)
Peptidases [BR:phd01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102335205 (CTRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 256 aa AA seqDB search
MALLWVVLGFFFFGSSFGCGVPAIDPVLSGLSRIVNGEDAVPGSWPWQVSLQTSSGFHFC
GGSLISEDWVVTAAHCRVRXGPTSPAQRDHLYLAVLAQVFEHPQWDLRAVRNDVALLKLA
APARLSAAVAPVCLPSADTSFPPGSLCTVTGWGKTRYNAFDTPDKLQQATLPILSNADCK
EFWGSKITDVMICAGASGISSCMGDSGGPLVCQKDGAWTLAGIVSWGSSRCSPFLPGVYA
RVTKFIPWILEVLEAH
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcccttctctgggttgtccttggcttcttcttctttggcagcagcttcggttgcggg
gtcccggccatcgaccctgtgctgagcggcctctccagaattgtcaacggggaggacgcc
gtgcccggctcctggccctggcaggtgtccctgcagaccagctccggcttccacttctgt
gggggctccctcatcagtgaggactgggtggtcaccgccgcccactgcagggtcaggtga
ggccccacttcacctgctcaaagggaccacctttacctcgctgtccttgcgcaggtcttc
gaacacccgcagtgggacctgcgcgccgtgcgcaacgacgtggccctgctgaagctggcg
gcgcccgcccgcctctccgcagccgtggcccctgtctgcctgcccagcgcagacaccagc
ttccccccgggctccctgtgcaccgtcaccggctggggcaagacccggtacaatgccttc
gatacccctgacaagctgcagcaggccaccctgcccatcctgtctaatgccgactgcaaa
gagttctggggcagcaagatcactgacgtgatgatctgtgcgggggccagcggcatctcc
tcctgcatgggcgactccggcggccccctggtctgccagaaggacggagcctggaccctg
gcgggcatcgtgtcctggggcagcagccggtgtagcccattcttacctggcgtatatgcc
cgggtcaccaagttcattccctggattcttgaagttctggaggcccactga

DBGET integrated database retrieval system