KEGG   Pantholops hodgsonii (chiru): 102335545Help
Entry
102335545         CDS       T02909                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:phd00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 368 aa AA seqDB search
MASKSWLNILTFLCGSAVGFVLCSQLLSILLEEQKDIQPSILHNDPHARHSDDNEQNHLE
GQMNFDADASQHKDENTDIAEKLYQKVKILCWVMTGPQNLEKKAKHVKATWAQRCNKVLF
MSSEENKDFPAVGLKTREGRDQLYWKTIKAFQYVHDHYLEDADWFMKADDDTYVILDNLR
WLLSKYNPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVEAFKTDKCTHSSSIED
LALGRCMEIINVEAGDSRDTTGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGC
CSDLAVSFHYVDPTTMYELEYLVYHLRPYGYLYRYQPALPEKILKEVSQIYKNEDTKVNQ
EPLKEKHK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcctctaaatcttggctgaatattttaaccttcctttgtggatcagcagtcggattt
gttttatgctctcagctacttagtattttgttggaagaacagaaggacatccagcctagt
attcttcataatgatcctcacgctaggcattcagatgacaatgaacagaatcatctagaa
ggacagatgaacttcgatgcagatgccagccaacataaagatgagaacactgacatcgct
gaaaagctctatcagaaggttaaaattctttgctgggtaatgacagggcctcagaatcta
gagaaaaaggctaaacatgtcaaagctacatgggcccagcgttgtaataaagtgttgttt
atgagttcagaagaaaacaaggacttccctgctgtgggattaaaaaccagagaaggcaga
gaccagctgtactggaaaacaattaaagcctttcagtatgtccatgatcattatttagaa
gatgctgattggtttatgaaagcagatgatgatacttacgttatactagataacttgaga
tggcttctctcaaaatacaaccctgaagaacccatttactttgggagaagatttaagccc
tatgtaaagcagggctacatgagtggaggagcaggatatgtactgagtaaagaagctttg
aagagatttgttgaggcatttaaaacagacaaatgtactcacagctcctcaatcgaagat
ttagcactggggagatgcatggaaattataaatgtagaagcgggagattccagagatacc
accggaaaagagacttttcatcctttcgtaccagagcaccacttaatcaagggttatctg
ccgagaaccttctggtactggaattataactattatcctcctgtagagggtcctggttgc
tgttctgatcttgcagtttcttttcactatgttgatcctacaactatgtatgagttagaa
tacctcgtttatcatcttcgtccgtatggttatttatacagatatcaacctgccttacct
gagaagatactaaaggaagtaagtcagatatacaaaaatgaagatacaaaagtaaatcag
gagcccttgaaagaaaaacataaatga

DBGET integrated database retrieval system