KEGG   Pantholops hodgsonii (chiru): 102335545Help
Entry
102335545         CDS       T02909                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:phd00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    102335545
Enzymes [BR:phd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     102335545
Glycosyltransferases [BR:phd01003]
 Glycan extension
  Type 3 chain
   102335545
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 368 aa AA seqDB search
MASKSWLNILTFLCGSAVGFVLCSQLLSILLEEQKDIQPSILHNDPHARHSDDNEQNHLE
GQMNFDADASQHKDENTDIAEKLYQKVKILCWVMTGPQNLEKKAKHVKATWAQRCNKVLF
MSSEENKDFPAVGLKTREGRDQLYWKTIKAFQYVHDHYLEDADWFMKADDDTYVILDNLR
WLLSKYNPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVEAFKTDKCTHSSSIED
LALGRCMEIINVEAGDSRDTTGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGC
CSDLAVSFHYVDPTTMYELEYLVYHLRPYGYLYRYQPALPEKILKEVSQIYKNEDTKVNQ
EPLKEKHK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcctctaaatcttggctgaatattttaaccttcctttgtggatcagcagtcggattt
gttttatgctctcagctacttagtattttgttggaagaacagaaggacatccagcctagt
attcttcataatgatcctcacgctaggcattcagatgacaatgaacagaatcatctagaa
ggacagatgaacttcgatgcagatgccagccaacataaagatgagaacactgacatcgct
gaaaagctctatcagaaggttaaaattctttgctgggtaatgacagggcctcagaatcta
gagaaaaaggctaaacatgtcaaagctacatgggcccagcgttgtaataaagtgttgttt
atgagttcagaagaaaacaaggacttccctgctgtgggattaaaaaccagagaaggcaga
gaccagctgtactggaaaacaattaaagcctttcagtatgtccatgatcattatttagaa
gatgctgattggtttatgaaagcagatgatgatacttacgttatactagataacttgaga
tggcttctctcaaaatacaaccctgaagaacccatttactttgggagaagatttaagccc
tatgtaaagcagggctacatgagtggaggagcaggatatgtactgagtaaagaagctttg
aagagatttgttgaggcatttaaaacagacaaatgtactcacagctcctcaatcgaagat
ttagcactggggagatgcatggaaattataaatgtagaagcgggagattccagagatacc
accggaaaagagacttttcatcctttcgtaccagagcaccacttaatcaagggttatctg
ccgagaaccttctggtactggaattataactattatcctcctgtagagggtcctggttgc
tgttctgatcttgcagtttcttttcactatgttgatcctacaactatgtatgagttagaa
tacctcgtttatcatcttcgtccgtatggttatttatacagatatcaacctgccttacct
gagaagatactaaaggaagtaagtcagatatacaaaaatgaagatacaaaagtaaatcag
gagcccttgaaagaaaaacataaatga

DBGET integrated database retrieval system