KEGG   Pantholops hodgsonii (chiru): 102336354Help
Entry
102336354         CDS       T02909                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd00250  Alanine, aspartate and glutamate metabolism
phd00410  beta-Alanine metabolism
phd00430  Taurine and hypotaurine metabolism
phd00650  Butanoate metabolism
phd01100  Metabolic pathways
phd04727  GABAergic synapse
phd04940  Type I diabetes mellitus
Module
phd_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:phd00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    102336354
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102336354
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102336354
   00430 Taurine and hypotaurine metabolism
    102336354
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    102336354
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    102336354
Enzymes [BR:phd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     102336354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS
Motif
Other DBs
NCBI-GeneID: 102336354
NCBI-ProteinID: XP_005972880
Position
Un
AA seq 547 aa AA seqDB search
MPQHKACHNTHAEPRGRRLHTAMCQSVLRGLRERGTMEGVSQAPPGSCFFLFSLDLLPSK
EGEDLTKCFLLRVVNILLHYIEKTFDVKSKILDFHHPHQLLEGLDGFDLELSDHPESLEQ
LLVDCTDTLKYGVKTGHPRYFNQLSSGLDVIGLAGEWLTATANTNMFTYEIAPVFTVMET
VLLKKMCGIIGWRETEADGIFSPGGSTSNLYGILVARYKQYPEIKARGMAVLPRIVLFVS
EQGHYSIKKAAATLGIGTDNVIEVKCDERGKMIPAELEKNILQAKRKGQTPFCVVATAGS
TVFGAFDPLHDIADICEMHRLWMHVDAAWGGGLLLSRKHSYKLSGIERADSVTWNPHKLM
GVPLQCSALLTREKGLLGACNQMQAEYLFQPDKVYNINFDTGDKTIQCGRRVDVFKLWLM
WKAKGTYGFEVQIDRYMELAKYFYKVLKKKDDFKLVFDAEPEFTNVCFWYFPPRLKHIPK
SFERDQELQKIAPKIKAQMIVEGTVMLSYQPCGDKVNFFRMVFSNPATRQTDVDYLIDEI
QRLGKDL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaacacaaagcgtgtcacaacacgcacgcagagccacgcgggagacgcctgcac
accgcgatgtgtcagagcgtgctgcgcggattgcgagagcgtggcacaatggagggagtg
tcacaagcgccccctgggagttgtttctttcttttttctctagatttgttgccatccaag
gagggcgaagatttaacaaaatgttttctgctgcgagtggtaaatattcttctgcactac
attgagaaaacttttgatgttaagagtaaaatattggactttcatcatcctcatcaactt
cttgaaggtttggatgggtttgacttagaactgtctgaccatcctgaatctctggaacag
ttgcttgttgattgtacagacaccttaaaatatggtgtaaaaacaggacatcctcgctat
tttaaccagctctccagcgggctagatgtgattggacttgcaggggaatggttgacagcc
actgcaaataccaacatgtttacctatgaaatagctccagtatttactgtcatggaaaca
gttcttcttaagaaaatgtgtggaattattggctggagagaaacagaagcagatggaata
ttttcacctggtgggagtacatcaaacctctatggtatattagtagctcgttataagcaa
tatccagagataaaagcaagaggcatggcagtccttccacgcattgtattgtttgtttct
gaacaaggtcattattccataaaaaaagctgcagcaactcttggtattggaacagataat
gtaattgaagtaaaatgtgatgaaaggggaaagatgattccagctgagttagagaaaaat
atattacaagctaaaagaaagggccagactcctttctgtgtggtggccacagctggcagc
accgtgttcggggccttcgacccgctccatgacatcgcagatatttgtgagatgcacaga
ctctggatgcacgtggatgcagcttggggaggtggattgctgttgtccagaaagcattcc
tataaactcagtggcattgaaagggccgactccgtgacctggaacccccacaaactcatg
ggtgtgccccttcagtgctctgctctcctgacccgggaaaaaggtcttctgggagcatgc
aaccagatgcaggctgaataccttttccagcctgataaagtctacaatattaactttgac
accggggataaaactattcaatgcggccgacgtgttgatgtctttaagctctggttaatg
tggaaggcaaagggaacctatggcttcgaggtacagattgacagatatatggaacttgca
aaatacttctataaagttttaaagaaaaaagatgactttaagcttgtatttgatgcagag
cctgagttcaccaatgtctgcttctggtatttcccaccaagacttaaacacatcccaaaa
agttttgaaagagatcaagaactgcaaaagattgctccaaagattaaagcacagatgata
gtggaaggtacagtcatgctcagctaccagccctgtggggacaaagtaaattttttccga
atggtcttttctaatcctgccacaagacaaacagatgttgactatcttattgatgaaatt
caaagacttgggaaagatttatga

DBGET integrated database retrieval system