KEGG   Pantholops hodgsonii (chiru): 102336532Help
Entry
102336532         CDS       T02909                                 

Gene name
GPT
Definition
glutamic-pyruvate transaminase (alanine aminotransferase)
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:phd01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:phd01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:phd01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:phd00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 543 aa AA seqDB search
MWVSCPLSWGRWAGTGPHPKPRLPSHPLPVAPRAELCPDGRGLAARLLQPLLSSQWGQQA
AAKRAPPSQAPPSQPWPTEPGPADLIPVSGSCRLLSLLPAHLSRVMALRAVEHSQEAANG
LKEKVLTLDSMNPCVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMG
QIPITFPRQVLALCVHPDLLNSPDFPDDAKRRAERILQACGGHSLGAYSISAGVQMIRED
VARYIERRDGGIPADPNNIFLSTGASDAIVSRARPRLTPDLSHPRAPGQVQTRACIEDVI
RFALEERLFLLADEVYQDNVYAEGSQFHSFKKVLMEMGPPYAARQELASFHSISKGFMGD
PPRCGFRGGYVEVVNMDAAVKQQMQKLRSVRLCPPTPGQVLLDVAVSPPAPPIPSDPSFA
QFQAERRAVLAELAAKAKLTEQVFNEAPGIRCNPVQGAMYSFPRMELPPRAVQRAQELGL
APDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPMEKLRPLLEKLSQFHAKFTR
EYS
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtgggtctcctgtcctctgtcctggggacgctgggcgggcaccgggcctcaccccaag
ccccgcctgccttctcacccactccctgtggctcccagggcagaactgtgcccagacggg
cggggcctggcagcccggctccttcagcctcttctgtcctctcagtggggccagcaggct
gcagccaagagggcgcccccttcccaggctcccccttcccagccctggcccaccgagcct
ggaccagctgacctcatccccgtttctggatcctgccgcctcctgagcctccttcctgcc
catctgagcagagtcatggccttgagggcagtggagcacagccaggaggcagcaaatggg
ctgaaggagaaggtgctgacactggactccatgaatccttgtgtccggagggtggagtat
gcagtgcgaggcccgattgtgcagcgggcactggagctggagcaggagctgcgccagggc
gtaaagaagcccttcaccgaggtcattcgcgctaacatcggggacgcacaggccatgggg
cagatccctatcaccttcccgcgccaggtcctggccctctgcgtccaccccgatctcctg
aacagccctgacttccccgacgacgccaagaggagggcggagcgcatcttgcaggcgtgt
gggggccacagcctgggggcctacagcatcagcgctggcgtccagatgatccgcgaggac
gtggcgcggtacatcgagcggcgcgatggaggcattcccgccgaccccaataacatcttc
ctgtccacgggggccagcgatgccattgtgagcagagcgcgccctcggctgaccccggac
ctgtcgcacccccgcgccccagggcaggtgcagacccgcgcgtgcatcgaggacgtgatc
cgcttcgcccttgaggagagacttttcctattggccgatgaggtgtaccaagacaacgtg
tatgccgagggctcgcagttccattcgttcaagaaggtgctcatggagatggggccgccg
tacgcggcgcgacaggagctcgcctccttccactcgatctccaagggcttcatgggcgac
ccgccccggtgcggcttccgcggcggctacgtggaagtggtgaatatggacgccgcggtg
aagcagcagatgcagaagctgcggagcgtgcggctgtgcccgcccaccccgggccaggtc
ctgctcgacgtggctgtcagcccgccggcgcctccgatcccttccgatccctccttcgcg
cagttccaggcggagaggcgggcggtgctggccgagctggctgccaaggccaagctcacg
gagcaggtcttcaacgaagctcccggcatccgctgcaacccggtgcagggcgctatgtat
tccttcccgcgcatggagctacccccacgtgcggtgcagcgggctcaggagctgggcctg
gctcccgacatgttcttctgcctgcgcctcctagaggagactggcatctgcgtggtgcct
gggagtggcttcggacaacgggaaggcacctaccactttcggatgactattctgcccccc
atggagaagttgcggcccctgctggagaagctgagccagttccatgctaagttcacccgc
gagtactcctga

DBGET integrated database retrieval system