KEGG   Pantholops hodgsonii (chiru): 102336969Help
Entry
102336969         CDS       T02909                                 

Gene name
HAT1
Definition
histone acetyltransferase 1
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
Alcoholism
Brite
KEGG Orthology (KO) [BR:phd00001]
 Human Diseases
  Substance dependence
   05034 Alcoholism
    102336969 (HAT1)
Enzymes [BR:phd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102336969 (HAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 435 aa AA seqDB search
MAGLINHFQLVFLKSCFLGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDL
ENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEA
DDVEGKIRQIIPPGFCTNTNDFLSLLEKEADFKPFGTLLHTYSVLSPTGGENFTFQIYKA
DMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTV
YNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRHYTASPSVLDITAEDPSKSYVK
LRDFVLVKFCQDLPCFSREKLMQGFSEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSD
AEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQE
LVEDYRRVIERLAQE
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtttgattaatcacttccaactagtctttttaaaatcctgtttcttaggattt
ggtgctatggagaagtttttggttgaatacaagagtgcagttgagaagaaactggccgag
tacaaatgtaacaccaacacagcaattgaactgaaattagttcgttttcctgaagatctt
gagaatgacattagaactttctttcctgagtatacccatcaactctttggggatgatgaa
actgcttttggttacaagggtctgaagatcttgttatattatattgctgggagcctgtca
acaatgttccgtgttgaatatgcatctaaagttgatgagaactttgactgtgtagaggca
gatgatgttgagggcaaaattagacaaatcattccacctggattttgcacaaacacgaat
gattttctttcgttgctggaaaaagaagctgatttcaagccatttggaaccttacttcac
acatactctgttctcagtccaacaggaggagaaaactttacctttcagatttataaggct
gacatgacatgtagaggctttcgagaatatcatgaaaggcttcagacctttttgatgtgg
tttattgaaactgctagctttattgacgtggatgatgaaagatggcactactttctagta
tttgagaagtataataaggatggagctacactctttgcgaccgtaggctacatgacagtc
tataattactatgtgtacccagacaaaacccggccacgtgtaagtcaaatgctgatattg
actccatttcaaggtcaaggccatggtgctcagcttcttgaaacagttcatagacactac
actgcatctccgtctgtccttgatattacagcggaagatccatccaaaagctatgtgaaa
ttgagagactttgtgcttgtgaagttttgtcaagatttgccctgtttttcccgggaaaag
ttaatgcaaggattcagtgaagatatggcaatagaggctcaacagaagttcaaaataaat
aagcaacatgctagacgggtttatgaaattcttcgactactggtaactgacatgagtgat
gctgaacaatacagaagctatagactggatattaaaagaagactaattagcccatataag
aaaaaacagagagatcttgctaaaatgagaaaatgtctcagaccggaagaactgacaaac
cagatgaaccagatagaaataagcatgcaacatgaacagctggaagaaagctttcaggaa
ctcgtggaagactatcgacgtgtcattgaacgcctcgctcaagagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system