KEGG   Pantholops hodgsonii (chiru): 102337371Help
Entry
102337371         CDS       T02909                                 

Gene name
EP300
Definition
E1A binding protein p300
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
cAMP signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Long-term potentiation
Melanogenesis
Thyroid hormone signaling pathway
Huntington's disease
Tuberculosis
Hepatitis B
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
MicroRNAs in cancer
Renal cell carcinoma
Prostate cancer
Brite
KEGG Orthology (KO) [BR:phd00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    102337371 (EP300)
   04330 Notch signaling pathway
    102337371 (EP300)
   04350 TGF-beta signaling pathway
    102337371 (EP300)
   04630 Jak-STAT signaling pathway
    102337371 (EP300)
   04066 HIF-1 signaling pathway
    102337371 (EP300)
   04068 FoxO signaling pathway
    102337371 (EP300)
   04024 cAMP signaling pathway
    102337371 (EP300)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    102337371 (EP300)
  Cell communication
   04520 Adherens junction
    102337371 (EP300)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102337371 (EP300)
   04916 Melanogenesis
    102337371 (EP300)
  Nervous system
   04720 Long-term potentiation
    102337371 (EP300)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102337371 (EP300)
   05206 MicroRNAs in cancer
    102337371 (EP300)
   05203 Viral carcinogenesis
    102337371 (EP300)
   05211 Renal cell carcinoma
    102337371 (EP300)
   05215 Prostate cancer
    102337371 (EP300)
  Neurodegenerative diseases
   05016 Huntington's disease
    102337371 (EP300)
  Infectious diseases
   05152 Tuberculosis
    102337371 (EP300)
   05166 HTLV-I infection
    102337371 (EP300)
   05164 Influenza A
    102337371 (EP300)
   05161 Hepatitis B
    102337371 (EP300)
   05168 Herpes simplex infection
    102337371 (EP300)
   05169 Epstein-Barr virus infection
    102337371 (EP300)
Enzymes [BR:phd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102337371 (EP300)
Transcription factors [BR:phd03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    102337371 (EP300)
Mitochondrial biogenesis [BR:phd03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102337371 (EP300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2311 aa AA seqDB search
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQGMASQAQQSSPGLGLINS
MVKSPMAQAGLTSPTMGMGTSGPNQGPTPSATGMMSSPVSQPAMGMNPGMNAGMNPGMLT
AGSGQGMMPNQVMNGSIGAGRGRPNMQYPNPGMGNAGNLMTEPLQQGSPQMGGQTGLRGP
QPLKMGMMNNPNPYGSPYTQNSGQQMGASGLGLQIPTKSVLPNSLSPFAMDKKAVPGGGM
PNMGQQQAPQVQQPGLVAPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNTSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
MPTQPQVQAKNPQNQQSGQSPQGMRPMSNMSASPMGVNGGVGVQPSNLLSDSMLHSAINS
QNPMMSDSGSVASLGPMPAAAQPSSAGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
SAASMVPVMNAGPNMGQPQPGMTSNGPLPDPSMIRGNVPNQMMPRVTPQPGLNQFGQMNM
PQPPIGPRQTSPLQHHVQLAQTGTLNPPMGYGPRMQQPSSQSQFLPQTQFSTQGMNVTNM
PLAPTGGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPPLPQPALHQNSPSPVPSRTP
TPHHTPPSIGAQQPPATAIPAPVPTPPAMPPGPQSQVLHPPPRQTPTPPPTQLPPQVQPS
LPAAPSVDQAQQQPLSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSST
EVNSQTIPEKQPSQEVKMEPKMEVEAPEPADTQPEDIPEPKAEDCKVEPTESEERGTELK
TETKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVD
PQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYK
YCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHF
CEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVL
HHEIIWPSGFVCDGCLKKTARTRKENKFSAKRLPSTRLGTFLENRVNEFLRRQNHPESGE
VTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQE
YGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPP
SEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDILKQATEDRLTSAKE
LPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNK
SSLSRGNKKKPGVPSVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIP
CDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETR
WHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQ
SLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPISPPNNMPPYLPRTQAAGPV
SQGKAAGQVTPPTPPQTAQPPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQM
PQMTPMAPMGMNPPPMARGPGGHLEPGMGPTGMQQQPPWAQGGLPPPQQLQSGMPRPAMM
SVSQHGQPLNMPPQTGLGQVGVSPLKPGTVSQQALQNLLRTLRSPSSPMQQQQVLSILHA
NPQLLAAFIKQRAAKYANSNPQPLPGQPGLQPPAMPGQQGVHSSPAMQNLNPMQAGVPRA
GLPQQPTQQQQLPPPMGGMSPQAQQMNMNHSTMPSQFRDILRRQQMLQQQGAGPGMGPGL
ANHNQFQPPQGVGYPAPQQPPPPRMQHHMQQMPQGNMGQMGQLPQALGAEAGASLQAYQQ
RLLQQQMGSPAQPNPMSPQQHMLPSQAQSPHLQGQQIPSLSNQVRSPQPVPSPRPQSQPP
HSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQGNPMEQGHFASPDQNSMLSQLASNPGMA
NLHGASATDLGLGTDNSDLNSNLSQSTLDIH
NT seq 6936 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaatgtcgtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtccgccagcgatggcacagactttggctctctgtttgacttggag
cacgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggcgat
attagtcagcttcagacaagtcttggcatagtacaagatgcagcctctaaacataaacag
ctgtcagaattgctacggtctggtagttcccctaacctcaatatgggggttggtggccca
ggccaaggcatggccagccaagcccaacagagcagtcctggattaggtttgataaatagc
atggtcaaaagcccaatggcccaggcaggcttgacttctcccaccatggggatgggcact
agtggaccaaatcagggtcccacgccgtctgcaacaggtatgatgagcagtccagtcagt
cagcctgccatgggaatgaacccggggatgaatgctggcatgaatcctggaatgttgact
gccggcagtggccaagggatgatgcctaatcaagtcatgaacggttcaattggagcaggc
cgggggcgacctaatatgcagtacccaaacccaggcatgggaaatgctggcaacttaatg
actgagccgctgcagcaaggctctccccagatgggaggacagacgggactgagaggcccc
cagcctcttaagatgggaatgatgaacaaccctaatccttacggttcaccatacactcag
aattctggacagcagatgggagccagtggccttggtctccagattccaacaaagtctgta
ctaccaaatagcttatctccatttgcaatggacaaaaaggcagttcctggtggaggaatg
cccaatatgggccagcagcaggccccacaggtccagcagccaggcctggtggctccggtg
gcccaggggatgggttctggggcacatacggctgatccggagaagcgcaagctcatccag
cagcagcttgtcctcctcctgcacgctcacaagtgccagcgccgggagcaggccaatggg
gaggtgaggcagtgcaaccttccccactgtcgaaccatgaagaatgtccttaaccacatg
acacactgccagtcgggcaagtcctgccaagtggcacactgtgcatcttctcgacaaatc
atttcacactggaagaattgtacaaggcatgattgtcctgtatgtctaccccttaaaaat
gctggagataagagaaatcaacagtcaattttgactggagcaccagttggacttggcaat
actagctctctaggggtgggtcaacagtccactcccagcctaagcactgtcagtcagatt
gatcccagctctatagaaagagcctatgcagcccttggactgccctatcaagtaaatcag
atgccgacccagccccaggtgcaagcgaagaatccgcagaaccagcagtctgggcagtct
ccccaagggatgcggcccatgagcaacatgagtgctagtcctatgggagtaaatggaggt
gtaggggttcaaccttcgaatcttctttctgactcgatgttgcattcagccataaattct
caaaacccaatgatgagtgacagcggcagtgtggcctctctgggtcctatgccagcagca
gctcaaccatccagtgctggaattcggaagcaatggcatgaagatattactcaggatctt
cgaaatcatcttgtccacaaacttgttcaagccatatttcccactccggatcctgctgct
ttaaaagacagacggatggaaaacctagttgcatatgcccggaaagtggaaggggacatg
tatgaatcggcaaacaatcgagcggaatactaccacctgttagctgagaagatctataag
attcagaaggaactagaagaaaagcgaaggactagactacagaaacagaacatgctacca
agtgctgcaagcatggtgccagttatgaacgcagggcctaacatggggcagccacaacca
ggaatgacttctaatggccccctccctgatccatctatgatccgtggcaatgtgccaaac
cagatgatgcctcgggtaactccacagcctggtttgaatcaatttggccagatgaatatg
cctcagccccctatcggaccccggcaaacctctcctcttcagcaccatgtacagttagct
caaactggaacacttaacccgcctatgggctacgggcctcgcatgcagcagccttccagc
cagagccagtttcttcctcagactcaattctcaacacagggaatgaatgtaacaaatatg
cctttggctccgactggcggtcaagcaccagtatctcaagcacagatgtccagttcttcc
tgtcctgtgaactctcctataatgcctcctgggtctcaagggagccacattcactgtccc
cctctccctcaaccagctctgcatcagaactcaccctcacccgtacctagtcgcaccccc
acccctcaccacactccccctagcataggggctcagcagccaccagcaacagcaatccca
gcccctgttcctacgcctccagccatgccacctggcccacagtcccaggttctccatccg
cctccaagacagacgcctacgccgccgccaacgcagcttcctccccaagtgcagccttcg
cttcctgctgctccctcagttgaccaggcgcagcagcagcctctgtcccagcaaagcaca
gcagcctctgtgcccaccccgaccgcacccctgctgcctccgcagccggcaactccactt
tcccagccagctgtcagcattgaagggcaggtatcaaaccctccatctactagtagcacg
gaagtgaattctcagaccattcctgagaagcagccttcacaggaagtaaaaatggagcct
aaaatggaagtggaggcaccagaaccagcagatactcagccagaggatattccagagcct
aaagcagaagactgtaaagtagaacctacagaaagcgaagagcgaggcactgaattaaaa
acggagacgaaagaggaagaagaccagccaagtacttcagcaacccagtcatctccagcc
ccgggacagtcaaagaagaagattttcaaacctgaagagttacggcaggcactaatgcca
acattggaggcactttaccgacaggatccggaatcccttccctttcgtcagcctgtggac
cctcagcttttaggaatccctgattactttgatattgtgaagagccctatggatctttct
accatcaagaggaagttagacactggacagtatcaggagccctggcagtatgtggatgac
atttggctcatgttcaacaatgcttggttatataatcggaaaacatcacgggtgtacaaa
tactgctccaagctgtctgaggtctttgaacaagaaattgaccctgtcatgcaaagcctt
ggatactgttgtggcagaaagttggagttctctccacagacactctgttgctatggcaaa
cagttatgcacaatccctcgtgatgccacttactacagttatcagaacaggtatcatttc
tgtgagaagtgtttcaatgaaatccaaggggagagcgtttctttgggggatgacccttcc
caacctcaaactacaataaataaagaacaattttcaaagagaaaaaatgacactctggat
cctgaactgtttgtcgagtgtacagagtgtgggagaaagatgcatcagatctgtgtcctt
catcatgagatcatctggccatcgggatttgtctgtgatggttgtttaaagaagactgca
cgaactagaaaagaaaataaattttctgctaaaagactgccatctaccaggcttgggaca
tttctggagaatcgtgtgaatgagtttctgaggcgacaaaatcaccctgagtcaggagag
gtcactgttcgagtagttcatgcttctgacaaaactgtggaagtcaaaccaggcatgaaa
gcaagatttgtagatagtggagagatggcagaatcctttccatatcgaaccaaagccctc
tttgccttcgaagaaattgatggtgttgacttgtgcttctttggtatgcacgttcaagag
tatggctctgactgccctccgcccaaccagaggagagtatacatatcatacctcgatagt
gttcacttcttccgtcctaaatgcttgaggactgcagtctatcatgaaatcctaattgga
tatttggaatatgtcaagaaattaggatacacaacagggcatatttgggcgtgtccgcca
agtgaaggagatgactacatcttccattgccacccccctgaccagaagatacccaagccc
aagcgactgcaggagtggtacaaaaagatgctcgacaaagctgtgtccgagcgaatcgtc
catgattataaggatattttaaaacaagctactgaagatcgattgacaagtgcgaaggaa
ttgccttactttgagggagatttctggcccaacgtcctggaagagagcattaaggaactg
gagcaggaggaggaggagcggaagcgggaggagaacaccagcaacgagagcacagatgtg
acaaagggagatagcaaaaacgctaagaagaaaaacaacaagaaaactagcaaaaacaag
agcagcctgagtcggggcaacaagaagaagccaggcgtgcccagcgtgtccaacgacctc
tcacagaagttgtatgccaccatggagaagcacaaagaggtcttctttgtgatccgtctc
atcgctggccctgccgccaactccctgcctcccattgttgaccccgaccccctcatcccc
tgtgacctgatggatgggcgggatgcctttctcaccctcgcaagggacaagcacctggag
ttctcgtcactgcgaagagcccagtggtccaccatgtgcatgctggttgagctgcacacc
cagagccaggaccgctttgtctacacctgcaacgagtgcaagcaccacgtggagactcgc
tggcattgcaccgtgtgcgaggattatgacttgtgtatcacctgctacaacactaaaaac
cacgaccacaagatggagaagctcgggctggggcttgatgacgagagcaacaaccagcag
gctgccgccacgcagagcccgggagactcccgccgcctgagcatccagcgctgcatccag
tcgctggtgcacgcctgccagtgccgcaatgccaactgctcgctgccgtcctgccagaag
atgaagcgggtggtgcagcacaccaagggctgcaagcgcaagaccaacggcggctgcccc
atctcacctcccaacaacatgccgccctacttgcccaggactcaagctgctggcccggtg
tcccagggcaaggcagcaggccaagtgacccccccgaccccgcctcagactgctcagccc
ccacttccgggacctccacctgcagcagtggaaatggccatgcagattcagagggcagcc
gagacgcaacgccagatggcccacgtgcaaatctttcagcggccaatccagcaccagatg
ccgcagatgactcccatggcccccatgggtatgaacccgccccccatggccagagggcct
ggtgggcatttggagccagggatggggcccactggcatgcagcagcaacccccgtgggcc
cagggaggactgcccccgccccagcagctgcagtccgggatgccccggccagccatgatg
tcggtgtcacagcatgggcagcccctgaacatgcctccccagacgggcttgggccaggta
ggtgtgagccctctcaagccaggcactgtgtctcaacaagccttacagaacctcctgcgg
actctcaggtctcccagctcccccatgcagcagcaacaggtgctcagtatccttcatgcc
aacccccagctattggctgcgttcatcaaacagcgggctgccaagtacgccaactccaac
ccgcagccgctccccgggcagccgggcctgcagccccccgccatgccaggtcagcagggg
gtccactccagccccgccatgcagaacttgaaccccatgcaggcaggtgtcccgagggct
ggcttgccccagcagcccacacagcagcaacagctcccaccacccatgggtgggatgagc
ccgcaggctcagcagatgaacatgaatcacagcaccatgccctcgcaattccgagacatc
ttgaggcgacagcagatgttgcagcagcagggagcggggccagggatgggcccggggctg
gccaaccacaaccagttccagcccccgcagggcgtgggctaccctgccccacagcagccg
ccaccgccacgaatgcagcaccacatgcagcagatgccgcaggggaacatgggacagatg
ggccagctcccgcaggccctgggagcagaggcgggagccagtctgcaggcctaccagcag
cggctcctgcagcagcagatgggctcgccggcccagcccaaccccatgagcccccagcag
cacatgctcccaagtcaggctcagtccccgcatctccaaggccagcagatcccgtctctc
tccaatcaagtgcgatctccccagcctgtcccgtctccgcggccgcagtcccagcccccc
cactccagcccttccccacggatgcagcctcagccttctccacaccacgtctccccacag
accagttctccacatcctggactggtcgctgcccagggcaaccccatggaacaagggcat
tttgccagcccggaccagaattcgatgctctctcagctcgctagcaatccaggcatggca
aacctccatggtgcgagcgccacggacctgggactcggcaccgacaactcagacttgaat
tcaaacctctcacagagtacactagacatacactag

DBGET integrated database retrieval system