KEGG   Pantholops hodgsonii (chiru): 102337685Help
Entry
102337685         CDS       T02909                                 

Gene name
MAOA
Definition
monoamine oxidase A
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Dopaminergic synapse
Cocaine addiction
Amphetamine addiction
Alcoholism
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:phd00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:phd00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:phd00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:phd00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:phd00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:phd00380]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:phd00982]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:phd04728]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:phd04726]
Human Diseases; Substance dependence; Cocaine addiction [PATH:phd05030]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:phd05031]
Human Diseases; Substance dependence; Alcoholism [PATH:phd05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 527 aa AA seqDB search
MESLQKTSDAGQMFDVVVIGGGISGLSAAKLLAEHEVNVLVLEARERVGGRTYTVRNEHV
DYVDVGGAYVGPTQNRILRLSKQLGLETYKVNVNERLVHYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTMDNMGKEIPADAPWEAPHAVEWDKMTMKDLIEKICWTKTARQFASLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSITNGGQERKFVGGSSQVSERIMQLLGDRVKL
RSPVTYVDQSSENITIETLNRELYECRYVISAIPPTLTAKIHFRPELPSERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEEAPISITLDDTKPDGSLPAIMGFILARKADR
LAKVHKDIRKRKICELYAKVLGSQEALHPVHYEEKNWCQEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIYFAGTETATQWSGYMEGAVEAGERAAREVLNALGKLAAKDIWIQEPEAED
VPAVEITPSFWERNLPSVPGLLKIVGFSTSMTALWFVMYRFRLLSRS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggagagtctgcagaagacgagtgacgcgggccagatgttcgacgtagtcgtgatagga
ggcggcatctcaggattatctgctgccaaactcttagccgaacatgaagttaatgttttg
gttttagaagcccgggagagagttggaggaagaacatacacagtgaggaatgagcatgtt
gactacgtagatgttggcggtgcttatgtaggcccgacccagaacaggatcttacggtta
tctaagcaactgggtttagaaacttacaaagtgaatgtaaatgagcgtcttgttcattat
gtcaagggaaaaacttatccatttcggggtgccttccctccagtatggaatcccattgcc
tatctggattacaacaacctgtggcggaccatggataacatgggaaaagagattccagct
gatgcaccatgggaggccccacatgcagtggaatgggataagatgactatgaaagatctc
atcgaaaaaatctgctggacaaagactgctcggcagtttgcatctctctttgtgaatatc
aatgtgacctctgaaccccatgaggtgtctgccctgtggttcttgtggtacgtgaaacaa
tgtggaggcaccactcggatattctccattaccaacgggggccaggaacggaagtttgta
ggtggatccagtcaagtaagcgaacggataatgcaactcctaggggacagggtgaaactg
aggagtcctgtcacttatgttgaccagtcaagtgaaaacatcaccatagagaccctgaat
cgtgaactttatgagtgccgatatgtcattagcgccatcccaccaactttgactgccaag
atacactttagaccagagcttccatcagagcgaaaccagctgatacagcgtcttccaatg
ggggctgtcattaagtgcatgatgtattacaaggaggccttttggaagaaaaaggattac
tgtggctgtatgatcatcgaagatgaggaagctccaatttcaataacgttggatgatacc
aagccagatggatcactgcctgctatcatgggctttatcctcgctcgaaaagctgaccgc
cttgctaaagtgcataaagatataagaaaaaggaaaatctgtgaactgtacgccaaagtg
ctaggatctcaagaagctttacatccagtgcactatgaagagaagaactggtgtcaggag
cagtactccggaggctgctacactgcctacttccccccagggatcatgactcaatatgga
agggtgattcgccaacctgtaggcaggatttactttgctggcactgagactgccacacaa
tggagcggttacatggaaggagcagtagaggctggtgaacgagcagctagagaggttttg
aatgctttggggaagctggctgccaaagatatctggatccaagaacctgaagctgaagat
gttccagctgtagagatcacccccagcttctgggagagaaacctgccttccgtaccaggc
ctgctgaagatcgttgggttttccacatcgatgactgccctgtggtttgtgatgtacaga
ttcaggctgctaagccgatcctga

DBGET integrated database retrieval system