KEGG   Pantholops hodgsonii (chiru): 102337685Help
Entry
102337685         CDS       T02909                                 

Gene name
MAOA
Definition
monoamine oxidase A
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Dopaminergic synapse
Cocaine addiction
Amphetamine addiction
Alcoholism
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:phd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102337685 (MAOA)
   00330 Arginine and proline metabolism
    102337685 (MAOA)
   00340 Histidine metabolism
    102337685 (MAOA)
   00350 Tyrosine metabolism
    102337685 (MAOA)
   00360 Phenylalanine metabolism
    102337685 (MAOA)
   00380 Tryptophan metabolism
    102337685 (MAOA)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    102337685 (MAOA)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    102337685 (MAOA)
   04726 Serotonergic synapse
    102337685 (MAOA)
 Human Diseases
  Substance dependence
   05030 Cocaine addiction
    102337685 (MAOA)
   05031 Amphetamine addiction
    102337685 (MAOA)
   05034 Alcoholism
    102337685 (MAOA)
Enzymes [BR:phd01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     102337685 (MAOA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 527 aa AA seqDB search
MESLQKTSDAGQMFDVVVIGGGISGLSAAKLLAEHEVNVLVLEARERVGGRTYTVRNEHV
DYVDVGGAYVGPTQNRILRLSKQLGLETYKVNVNERLVHYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTMDNMGKEIPADAPWEAPHAVEWDKMTMKDLIEKICWTKTARQFASLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSITNGGQERKFVGGSSQVSERIMQLLGDRVKL
RSPVTYVDQSSENITIETLNRELYECRYVISAIPPTLTAKIHFRPELPSERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEEAPISITLDDTKPDGSLPAIMGFILARKADR
LAKVHKDIRKRKICELYAKVLGSQEALHPVHYEEKNWCQEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIYFAGTETATQWSGYMEGAVEAGERAAREVLNALGKLAAKDIWIQEPEAED
VPAVEITPSFWERNLPSVPGLLKIVGFSTSMTALWFVMYRFRLLSRS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggagagtctgcagaagacgagtgacgcgggccagatgttcgacgtagtcgtgatagga
ggcggcatctcaggattatctgctgccaaactcttagccgaacatgaagttaatgttttg
gttttagaagcccgggagagagttggaggaagaacatacacagtgaggaatgagcatgtt
gactacgtagatgttggcggtgcttatgtaggcccgacccagaacaggatcttacggtta
tctaagcaactgggtttagaaacttacaaagtgaatgtaaatgagcgtcttgttcattat
gtcaagggaaaaacttatccatttcggggtgccttccctccagtatggaatcccattgcc
tatctggattacaacaacctgtggcggaccatggataacatgggaaaagagattccagct
gatgcaccatgggaggccccacatgcagtggaatgggataagatgactatgaaagatctc
atcgaaaaaatctgctggacaaagactgctcggcagtttgcatctctctttgtgaatatc
aatgtgacctctgaaccccatgaggtgtctgccctgtggttcttgtggtacgtgaaacaa
tgtggaggcaccactcggatattctccattaccaacgggggccaggaacggaagtttgta
ggtggatccagtcaagtaagcgaacggataatgcaactcctaggggacagggtgaaactg
aggagtcctgtcacttatgttgaccagtcaagtgaaaacatcaccatagagaccctgaat
cgtgaactttatgagtgccgatatgtcattagcgccatcccaccaactttgactgccaag
atacactttagaccagagcttccatcagagcgaaaccagctgatacagcgtcttccaatg
ggggctgtcattaagtgcatgatgtattacaaggaggccttttggaagaaaaaggattac
tgtggctgtatgatcatcgaagatgaggaagctccaatttcaataacgttggatgatacc
aagccagatggatcactgcctgctatcatgggctttatcctcgctcgaaaagctgaccgc
cttgctaaagtgcataaagatataagaaaaaggaaaatctgtgaactgtacgccaaagtg
ctaggatctcaagaagctttacatccagtgcactatgaagagaagaactggtgtcaggag
cagtactccggaggctgctacactgcctacttccccccagggatcatgactcaatatgga
agggtgattcgccaacctgtaggcaggatttactttgctggcactgagactgccacacaa
tggagcggttacatggaaggagcagtagaggctggtgaacgagcagctagagaggttttg
aatgctttggggaagctggctgccaaagatatctggatccaagaacctgaagctgaagat
gttccagctgtagagatcacccccagcttctgggagagaaacctgccttccgtaccaggc
ctgctgaagatcgttgggttttccacatcgatgactgccctgtggtttgtgatgtacaga
ttcaggctgctaagccgatcctga

DBGET integrated database retrieval system