KEGG   Pantholops hodgsonii (chiru): 102338123Help
Entry
102338123         CDS       T02909                                 

Definition
liver carboxylesterase-like
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phd00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102338123
Enzymes [BR:phd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     102338123
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 567 aa AA seqDB search
MMWLFALVLTSISTFTAWAGLPPSPPVVDTAQGRVRGKHVSLKGFAQPVAGFPGVPFAKP
PLGSWRFAPPQPAEPWSFVKNTTCHPPMCSQDPVGAQLLSDLFTNRKESISLTFSEDCLY
LNIYTPADLTKRSRLPVMVWIHGGGLMVGGASTYDGLALSAHENVVVVTIQYRLGIWGFF
STGDEHCRGNWGHLDQVAALHWVQENIANFGGDPGSVTIFGESAGGESVSVLVLSPLSRN
LFHRAISESGVALTSALVKRDSKAAAEQIAAFAGCKTITSAVLVHCLRQKTEDELLEVTQ
KMNFFKVDLYGDPRETHPFLPTVVDGVLLPKLPEEVLAEKNFNTVPYIIGVNKQEFGWLL
PLLVRYPLAEDKLDQKTATSLVWQYYPILSIPEQLAPVATDKYLGGTDDPVKKKGLFLDL
IADVMFGVPSVNVARCHRDAGAPTYMYEFHYRPSFLAELKPKTVIGDHGDELFSVFGAPF
LKDGASEEEINLSKMVMKYWANFARNGNPNGEGLPHWPVYDHREGYVQIGVNTQEAEKLK
NKEVAFWNELLSGEAAKKAPHLKHVEL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggctcttcgcgctggttctgacctccatctctactttcacagcttgggcaggg
ctgccgccctcaccgcctgtcgtggacaccgctcagggcagagtccgggggaaacatgtc
agcttaaaaggatttgctcagcctgtggccggcttcccgggagtcccctttgccaagcct
cctcttggatcctggaggtttgccccgccgcagcctgcagagccatggagcttcgtgaag
aataccacctgtcaccctcccatgtgctcccaagacccagtgggggcgcagttgctctca
gatctctttacgaacagaaaggagagcattagtctcacgttttctgaagactgtctttac
ctaaacatatacacccctgctgacttgacgaagagaagcaggctgccggtgatggtgtgg
atccacggaggaggtctcatggtgggcggggcatcaacctatgacgggctggccctctct
gcccatgaaaatgtggtggtggtgaccattcagtaccgcctgggcatctggggcttcttc
agcacaggggacgagcactgccgggggaactggggccacttggaccaggtggctgcgctg
cactgggtccaggagaacattgccaactttggaggggatccaggctctgtgaccatcttt
ggagagtcagcaggaggggaaagtgtgtctgtgcttgtgttgtcccccctgtccaggaat
ctcttccaccgggccatctctgagagcggcgtggccctcacttctgccctggtcaagagg
gactcgaaggctgcagctgagcaaattgctgcctttgctgggtgcaagaccatcacctca
gctgtccttgttcactgcctgcgccagaagacagaggatgagctcttggaggtaacacag
aagatgaactttttcaaagttgatttatatggagaccctagagagacccatcctttcctg
cccaccgtggttgacggagtgctgctgccaaagttgccagaagaggtgctggctgaaaag
aatttcaacaccgttccctacatcatcggagtcaacaagcaggagtttggctggcttctg
ccattgctcgtgagatatccacttgctgaagacaagctggaccagaagacggccacatca
ctcgtgtggcagtactaccccatcctgagcattcctgagcaactggctccagtggccacg
gacaagtatttaggagggacagacgaccctgtcaaaaagaaaggtctgttcctggacttg
atagcagatgtgatgtttggtgttccgtctgtgaatgtggcccgttgccacagagatgct
ggagccccaacctacatgtatgagtttcattatcgcccaagtttcttagcagagctgaaa
ccaaagacggtgataggagaccacggggatgagctcttctctgtcttcggggctccattt
ctgaaagatggtgcatcagaagaggagatcaatctcagcaagatggtgatgaaatactgg
gctaactttgctcggaatgggaaccccaatggggaggggcttccccattggccagtatat
gatcatagagaagggtacgttcagattggtgtcaacactcaggaagccgagaagctgaaa
aacaaggaagtggctttctggaacgagctactgtccggggaggcagcaaagaaggcacca
cacttaaaacatgttgagctgtga

DBGET integrated database retrieval system