KEGG   Pantholops hodgsonii (chiru): 102339562Help
Entry
102339562         CDS       T02909                                 

Gene name
ALDH1L1
Definition
aldehyde dehydrogenase 1 family, member L1
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
One carbon pool by folate
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:phd00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1048 aa AA seqDB search
MAGAGGGGGSSAVREGSSQWLEEWAAPSPSGPEQAALGGALGSGGQTTVSQSVLSAHFFG
GEPVASVWLLRRSPAPSLLGLDNCTTCAAATPESLGSPGVLAPVAAHSASSTAPTGLSPD
WPRLAHLLGSPPSSFPRCSGARPGKTASTGLLALTYVTQPAECWREMELGLGGWGQTLTR
CPAGLQAEQDGVPVFKFTRWRAKGRALPDVVAQYQALGAELNVLPFCSQFIPMEVISAPP
HGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFTIFWADDGLDTGDLLLQKECEVLPDDT
VSSLYNRFLFPEGVKGMVQAVKLIAEGKAPRLPQPEDGATYEGIQRKETARIDWDQPAEA
IHNWIRGNDKVPGAWTEACGQKLTFFNSTLNTAGLEPEGEDLPIPGAHRPGVVTKAGLVL
FGNDGRMLLVKNIQLEDGKMIPAARFFRRAESSTLELTEEELGTAEAVRDAWKRILPSVP
EVDESTDFFKSGAASVDVVRLVEEVKELCDGLELENEDVYMATTFGDFIQLLVRRLRGGD
KEAECAIAYVEKAVNKLTLRMPHQLFIGGAFVDAEGGKTYETINPTDGSVLCQVSLAQVS
DVDKAVAAAKDAFENGLWGKISARDRGRLLYRCKPRLHPQLMEQHQEELATIEALDAGAV
YTLALKTHVGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTMTRREPVGVCGIIIPWN
YPLMMLSWKTAACLAAGNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNVLPGSGSLVG
QRLSDHPDVRKIGFTGSTEVGKHIMRSCALSNVKKVSLELGGKSPLLIFADCDLGKAVQM
GMSSVFFNKGENCIAAGRLFVEDSIHDQFVQRVVEEVGKMKIGNPLDRDTDHGPQNHLAH
LQKLLEYCQRGVEEGATLMCGGKQVPRPGFFFEPTVFTDVQDHMFIAREESFGPVMIISR
FADGDVDAVLTRANATEFGLASGVFTRDINKALYVSDKLEAGTVFVNTYNKTDVAAPFGG
FKQSGFGKDLGEAALDEYLRVKTVTFEY
NT seq 3147 nt NT seq  +upstreamnt  +downstreamnt
atggcgggagcagggggcgggggcgggagctccgctgtgcgtgaggggtcgtcgcagtgg
ctggaggagtgggcagcccccagtccctcaggcccagagcaggcagcccttggaggagcc
ctgggctccggggggcagactactgtttcgcagtctgtgctgagcgcgcacttcttcggc
ggtgagcctgtagcctctgtgtggcttctacgcagatcccctgcgcccagtctcctgggg
cttgacaactgcacgacctgtgcggccgccactccagagagcttaggctcccctggtgtc
ctcgcacctgtggctgcccattcggcttcctccactgcacccactgggctctctcctgac
tggcccagactcgcccacctgctgggctccccaccctcctccttccctcgctgctctgga
gccagacctggaaagacagcgtccaccggcctcttggccctgacatacgtcacccaaccc
gcagagtgctggagggagatggagcttgggctcggaggctgggggcagactctcacccgc
tgtcccgcaggcctgcaggctgagcaggacggcgtgccagtgttcaagttcacccgctgg
cgggccaagggacgggccctgcccgacgtggttgcacagtaccaggccctgggagccgag
ctgaatgtgctgcccttctgcagccaattcatccccatggaggtcatcagcgcccccccg
cacggctccatcatctaccacccgagcctgctgccgcgccaccggggtgcctccgccatc
aactggaccctcatccatggggacaagaaaggggggtttaccatcttctgggcggacgat
ggtctggacaccggggaccttctgctccagaaggagtgtgaggtcctcccagatgacacc
gtcagctccctgtacaaccgctttctcttcccggaaggcgtcaaaggcatggttcaggct
gtgaagctgattgccgagggcaaagcccccagactccctcaacccgaggatggcgccacc
tacgaggggattcagaggaaggagacggccaggatcgactgggaccagccggcagaggcc
attcataactggatccgtgggaacgacaaggtgccaggcgcctggacagaggcctgcggg
cagaagctgacgtttttcaactcgacgctgaacacggcgggtctagagccggagggagag
gacctgcccatcccgggcgcccaccggccaggggtggtaaccaaagcgggcctcgtcctc
tttgggaacgacggccggatgctgctggtgaagaacatccagctggaggatgggaagatg
atcccagctgcgcgcttcttcaggagggcagagagcagcaccctggagctgacggaggag
gagctgggcaccgcagaggccgtgcgggatgcctggaagcggatcctccccagcgtgccg
gaggtggatgagtccacggacttcttcaagtcaggggccgcatccgtggacgtcgtcagg
ctggtggaggaggtcaaggagctgtgtgacggcctggaactggaaaatgaagatgtctac
atggcaaccaccttcggggacttcatccagctgttagtgagaaggctgcgagggggcgac
aaggaggccgagtgtgccatcgcctacgtggaaaaagccgtgaataagctgaccctccgg
atgccccatcagctgttcattgggggcgcatttgtggatgccgagggcggcaagacctac
gagaccatcaacccgacagacggcagtgtcctctgccaggtgtccctggcccaggtcagt
gacgtggacaaggccgtggccgctgcgaaggacgcctttgagaatggcctgtgggggaag
atcagcgcacgggaccgcggccgcctcctgtacaggtgcaagccccgcctgcatccgcag
ctcatggagcagcaccaggaggagctggccaccatcgaggccctggacgcaggcgcagtc
tacacgctggccctgaagacgcacgtgggcatgtccgtccagacctttcgctacttcgct
ggctggtgcgacaagatccagggctccaccatccccatcaaccaggccagacccaaccgg
aacttgactatgacccggagggagcccgtcggggtctgtggcatcatcatcccttggaac
taccccctgatgatgctgtcctggaagacggctgcctgcctggccgcgggcaacacagtg
gtgatcaagcctgcccaggtcaccccactcaccgccttgaagtttgcggagctgaccctg
aaggcgggcatccccaagggcgtggtcaatgtcctgccgggatccggttcactggttggc
cagagactgtcagatcacccagacgtgcggaagatcgggttcacagggtccaccgaggtc
ggcaagcacatcatgagaagctgcgccctgagcaatgtgaagaaggtctccctggagctg
ggtgggaagtcgcccctcctcatctttgcagactgtgacctgggcaaggccgtgcagatg
ggcatgagctccgtcttcttcaacaaaggcgagaactgcattgccgccggcaggctcttt
gtggaggactccatccacgaccagtttgtgcagagagtggtggaggaggtggggaagatg
aagattggcaatcccctggaccgggacaccgaccacgggccacagaatcacctggcccac
ctgcagaagctgctggagtactgccagcgtggtgtggaggagggggccacgctgatgtgc
ggcgggaagcaggttcctcggccaggcttcttcttcgagccgacggtcttcacagacgtg
caggaccacatgttcatagcccgggaggagtcctttgggcccgtcatgatcatctctcgg
tttgccgacggcgatgtggatgcagtgctgactcgagccaatgccacggagttcggcctg
gcctctggtgtcttcaccagggacatcaacaaggccctgtacgtcagtgacaagctggag
gctggcactgtgttcgtcaacacatacaacaagactgacgtggccgctcccttcggaggg
ttcaagcagtcagggttcggcaaagacctgggagaggccgccctagacgagtacctgcgg
gtcaagacggtcaccttcgagtactga

DBGET integrated database retrieval system