KEGG   Pantholops hodgsonii (chiru): 102339603Help
Entry
102339603         CDS       T02909                                 

Definition
protein O-mannosyl-transferase 1-like
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:phd00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    102339603
Enzymes [BR:phd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     102339603
Glycosyltransferases [BR:phd01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   102339603
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 483 aa AA seqDB search
MLGFLQHPVMVTAEVNLNMVALTAMGLLSRLWQLAYPRAVVSDEVYYGQYISFYMKRIFF
LDGSGPPFGHMLLALGGYLGGFPFSPRWWFWLVLTGVACSCAVGIKYVGVFTYLLVLRVA
AVHAWHVIGDQMLSNVRVLCHLLAGAAALVVLPILVYLLFFYIHLLLLYRGSSHQQQVTC
YPFKDVNNWWIVKDPGRHQLVVNNPPRPVRHGDVVQLVHGMTTRLLNTHDVAAPLSPHAQ
EVSCCVDYNISMPPQNLWRLDIVNRESDTDVWKTILSEVRFVHVNTSAILKLSGVPLPDW
GFRQLEVVGEKLFRGYHEITVWNVEEHCYGRSAEQKERELELHSPTQVDISRILSFMARF
SELQWRMLTVRSDDSEHKYSSTPLDWVMLDTNIAYWLHPRTSAQIHLLGNVVIWASASLA
TLAYALLFVWYLLRRRRRVCDLPEDRWLNWEIETLRQLAKGTETELCHLEQTRAKLGERQ
LSR
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgttgggattcttgcagcaccctgtgatggtgaccgctgaggtaaacttgaatatggta
gctctgaccgcgatgggattgctgagccgactatggcagcttgcttatccaagggccgtg
gtttctgatgaagtgtattacgggcagtacatctctttctacatgaagcggatcttcttt
ttggatggcagtggaccaccatttggccacatgcttttggccttgggaggttatttagga
ggattccccttctccccaagatggtggttttggttggtgctgacgggcgtggcctgctcc
tgtgcagttggcatcaagtacgtgggtgtgttcacatacttgctggtgctccgggttgcc
gctgtccacgcctggcacgtgataggagatcagatgctgtcaaacgtccgtgtgctctgc
cacctgctcgccggagcggcggccctggtggtgctcccgatccttgtgtacctgctgttc
ttctacatccacctgctgctgctctatcggggcagctcccaccagcagcaggtgacctgc
taccccttcaaggacgtcaacaactggtggattgtcaaagaccccgggaggcaccagctg
gtggtgaacaaccccccgaggcccgtgcggcacggcgacgttgtgcagctggtgcacggc
atgaccacccgcctcctcaacacgcatgacgtcgcagcccccctgagcccccacgcgcag
gaggtctcctgctgtgttgactacaacatctccatgcctccccagaacctctggcggctg
gacatcgtgaacagggagtcagacacggatgtctggaagaccatcttgtcagaggtccgc
tttgtgcacgtgaacacctcggccatcctcaagctgagtggagtgcccctcccagactgg
ggctttcggcagctggaagtggtgggggagaagctgtttcggggctaccacgagatcact
gtgtggaatgtggaggagcattgctacggcaggagcgcggagcagaaggagagggagctg
gagctgcactccccgacccaggtggacatcagcaggatcctcagcttcatggccagattc
tccgagctacagtggcggatgctgacggtgagaagtgacgattcggaacacaagtacagc
tccacgccactggactgggtcatgctggacaccaacatcgcttactggctgcaccccagg
accagtgcgcagatccacctgctcgggaacgttgtaatctgggcctctgccagcctcgcc
accctggcgtacgccctgctgtttgtctggtatctgctcagacgcagaaggagagtctgc
gacctccccgaggaccgctggctgaactgggaaattgagacactgcgccagttagccaag
ggaacagaaaccgaactctgtcacttggagcaaactagagccaagttgggagagagacaa
ctcagtagatga

DBGET integrated database retrieval system