KEGG   Pantholops hodgsonii (chiru): 102339705Help
Entry
102339705         CDS       T02909                                 

Gene name
SCD
Definition
stearoyl-CoA desaturase (delta-9-desaturase)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:phd00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    102339705 (SCD)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    102339705 (SCD)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    102339705 (SCD)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102339705 (SCD)
Enzymes [BR:phd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     102339705 (SCD)
Lipid biosynthesis proteins [BR:phd01004]
 Desaturase
  First
   102339705 (SCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 359 aa AA seqDB search
MPAHLLQEEISSSYTTTTTITAPPSRVLQNGGGKLEKTPLYLEEDIRPEMRDDIYDPTYQ
DKEGPKPKLEYVWRNVILMSLLHLGALYGITLILTCKIYTILWVLFYYMTSALGITAGVH
RLWSHRTYKARLPLRVFLIIANTMAFQNDVFEWARDHRAHHKFSETDADPHNSRRGFFFS
HVGWLLVRKHPAVREKGATLNLSDLRAEKLVMFQRRYYKPGVLLLCFILPTLVPWYLWGE
TFQNSLFFATFFRYAAVLNATWLVNSAAHMYGYRPYDKTINPRENILVSLGAVGEGFHNY
HHTFPYDYSASEYRWHINFTTFFIDCMAAIGLAYDRKKVSKAAILARMKRTGEESYKSG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccacttgctgcaagaggagatctctagctcctacacaaccaccaccaccatc
acagcacctccttccagggtcctgcagaatggagggggcaaattggagaagactccccta
tacttggaagaagacatccgccctgaaatgagagatgacatctatgacccaacttaccag
gataaggagggcccaaagcccaagcttgagtatgtttggagaaacgtcatcctcatgagt
ctgttacacttgggagccctgtatgggatcacattgatcctcacctgcaagatatacacc
attctctgggtgttattctactatatgacgagtgccctgggcatcacagcaggggtccat
cgcctgtggagtcaccgaacctacaaagctcggctgcctctgcgggtcttcctgatcatc
gccaacaccatggcattccagaatgacgtttttgaatgggcccgagatcaccgtgcccat
cacaagttttcagaaacggatgctgatccccacaattcccgacgtggctttttcttctct
cacgtgggttggctgcttgtgcgcaaacacccagctgtcagagaaaagggtgctacgcta
aatttatccgacctaagagccgagaagctggtgatgttccagagaaggtactacaaacct
ggtgtcctgctgttgtgcttcatcctgcccacactcgtgccgtggtatctatggggtgaa
acgtttcaaaacagcctattttttgccacctttttccgttacgctgctgtgctcaacgcc
acctggctggtgaacagcgctgcccatatgtatggatatcgcccttacgacaagaccatc
aacccccgagagaatatcctggtttccctgggagctgtgggtgagggcttccacaactac
caccacacctttccttatgactactctgccagcgagtaccgctggcacatcaactttacc
acattcttcattgattgcatggctgccatcggtctggcttatgaccggaagaaagtatcc
aaggctgccatcttggccaggatgaaaagaactggagaggaaagctacaagagtggctga

DBGET integrated database retrieval system