KEGG   Pantholops hodgsonii (chiru): 102339860Help
Entry
102339860         CDS       T02909                                 

Gene name
TGM1
Definition
transglutaminase 1
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
phd  Pantholops hodgsonii (chiru)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 822 aa AA seqDB search
MPSPTPSSGGPRSDVGRWGGNPWQPPTTPSPEPEPEPDRRSRRGGRSFWARCCGCCSCRN
TEDDDWGPERRGDRGGRGSGSRSRRPDSRGSDSRRPGSRGSAVNAAGDGTIREGMLVVTG
VDLLSSRSDQNRREHHTDEFEYDELILRRGQPFHMVLFLSRPYESSNHVTLELCIGNNPE
VGKGTHVIIPVGKGGSGGWKAQVTKSSGQNLNLRVHTSPNAIIGKFQFTIRTRCKAGEFQ
LPFDPRNEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFD
HGVLDACLYILDRRGMPYGGRSDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSA
WVGSVEILLSYLRTGNSVPFGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMD
IYFDENMKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGP
CSVQSIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGSLIITKAIGS
SMREDITHTYKHPEGSEAERKAVETAAAHGSKPNVYTTRDSTEDVAVQVEAQDAVMGQDL
TVCVVLTNRGSSPRTVKLHLYLSVTFYTGVTGSVFKESKKEVALAPGASERVTMPVAYKE
YRAQLVDQGAMLLNVSGHVKENGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFK
NPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDSPQ
LSQVHGVIQVDVAPAGGGGAFSDIRGSGRSGETIPMASRGGA
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgccaacaccttcatcagggggtcctcgctcagatgtcggccgctggggtgga
aacccctggcagccccccaccacaccttctccagagccggaaccagagccagacagacgt
tctcgccgcgggggccgttccttctgggctcgctgctgtggctgctgctcttgcaggaac
acagaagacgatgactgggggcctgagcgccgtggagaccggggaggtcgagggtctggc
tccaggagtcgaagacccgactccaggggctcagactcccgccggcctggctcccggggc
agtgctgtgaacgcagctggagatggcaccatccgggagggaatgctggtggtcactggc
gtggatctgctgagttcacgctcagaccagaaccgccgagagcaccacacagacgagttc
gagtacgatgagctgattctccgccgtgggcagcctttccatatggtcctcttcctgtct
cgtccctatgagtcttccaatcatgtcaccctggagctgtgcatcggaaacaatcccgag
gtgggcaagggcacccatgtgatcatcccggtgggcaagggcggcagtggaggctggaag
gcccaggtgaccaagtccagtgggcagaatctgaacctgcgggtccacacctcccccaac
gccatcatcggcaagtttcagttcaccatccgcacacgctgcaaagctggagagttccaa
ctgccctttgacccccgcaacgagatctacatcctcttcaatccctggtgccccgaggac
atcgtgtatgtggaccatgaggactggcggcaggagtatgtgcttaatgagtctgggcga
atttactatgggacagaagcgcagattggcgagcggacctggaactacggccagtttgac
cacggggtgctggacgcctgcctgtacatcctggaccggcggggcatgccctatggaggc
cgcagcgaccccgtcagtgtctcccgggtcatctctgccatggtgaactccttggatgac
aatggggtcctgattgggaactggtctggagattattcccgcggtaccaacccatcagca
tgggtgggtagcgtggagatccttctcagctacctacgcaccggcaactctgtccccttc
ggccagtgctgggtcttcgccggtgtgaccaccacagtgctgcgctgcctgggcctggcc
acccgtactgtcaccaacttcaactccgcgcacgacacagacacttccctcaccatggac
atctactttgatgaaaacatgaagcccctggagcacctgaaccatgattctgtctggaac
ttccacgtgtggaatgactgttggatgaagaggccagatctgccctcaggcttcgatggg
tggcaggttgtggacgccacaccccaggagaccagcagtggcatcttctgctgtgggccc
tgctctgtgcagtccatcaagaatggcttggtctacatgaagtatgacacacccttcatt
ttcgcagaggtaaacagtgacaaagtttactggcagcgacaggatgacggcagcttcaag
atcgtgtatgtggaggagaaggccatcggctccctcatcattacaaaggccatcggctcc
agcatgcgggaagacatcacgcacacctataagcaccccgaaggctcagaagcagagcgg
aaggcagtggagaccgcggccgcccacggcagcaaacccaacgtgtacaccacgcgggac
tcgacggaggatgtggccgtgcaggtggaggcgcaggacgcagtgatggggcaggacctg
acggtctgcgtggtgctgaccaaccgcggcagcagcccccgcaccgtgaagttgcacctc
tacctctctgtcaccttctacaccggcgtcacgggatccgtcttcaaggagagcaagaag
gaggtggcgctggcgccgggggcctcggagcgtgtgaccatgcccgtggcctacaaggaa
taccgggcccagctcgtagaccagggagccatgctgctcaacgtctcaggccacgtgaag
gagaacgggcaggtgctggccaagcagcacaccttccgtctgcgtaccccagacctcagt
ctcacgttactgggagcagctgtggttggccaggagtgcgaagtacagattgtctttaag
aacccactgcctgtcaccctcaccaacgtcgtcttccggctcgagggctccgggttgcag
aggcccaagatcctcaatgttggggacattgggggcaacgagacagtgaccctgcgccag
acgttcgtgcctgtgagaccaggtccccgccagctcattgccagcttggatagcccacag
ctctcgcaggtgcatggggtcatccaggtggacgtagccccagctggcggaggcggggcc
ttctcagacattagaggcagcggtcgctcaggggagaccatccccatggcctctcgaggt
ggggcttag

DBGET integrated database retrieval system