KEGG   Pantholops hodgsonii (chiru): 102341297Help
Entry
102341297         CDS       T02909                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Cholesterol metabolism
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:phd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102341297 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102341297 (LPL)
  Digestive system
   04979 Cholesterol metabolism
    102341297 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    102341297 (LPL)
Enzymes [BR:phd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     102341297 (LPL)
Exosome [BR:phd04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102341297 (LPL)
  Exosomal proteins of breast milk
   102341297 (LPL)
Glycosaminoglycan binding proteins [BR:phd00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   102341297 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:phd00537]
 Enzymes
  102341297 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 479 aa AA seqDB search
MESKALLLLALSVWLQSLTVSRGGLVAADRITGGKDFRDIESKFALRTPEDTAEDTCHLI
PGVTESVANCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRA
QQHYPVSAGYTKLVGQDVAKFMNWMADEFNYPLGNVHLLGYSLGAHAAGIAGSLTNKKVN
RITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGG
TFQPGCNIGEALRVIAERGLGDVDQLVKCSHERSVHLFIDSLLNEENPSKAYRCNSKEAF
EKGLCLSCRKNRCNNMGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESNTY
TNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLLYTEVDIGELLMLKLKWISDSYFSW
SDWWSSPGFDIGKIRVKAGETQKKVIFCSREKMSYLQKGKSPVIFVKCHDKSLNRKSGW
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaggccctgcttctgctggcactgagcgtgtggctgcagagtctgaccgtc
tcccgcggagggctggttgccgccgacaggattacaggaggaaaagattttagagacatt
gaaagtaaatttgctctcaggactcccgaagacacagctgaggacacttgccacctcatt
cctggagtgacggaatctgtggctaactgtcacttcaaccacagcagcaaaacctttgtg
gtgatccatggctggacggtgacaggaatgtatgagagttgggtgccaaaacttgtggct
gccttatacaagagggaaccagactccaacgtcatcgtggtggactggctgtcacgggcc
cagcagcattatccagtgtctgcagggtacaccaagctggtgggacaggatgtggccaag
tttatgaactggatggcggatgaatttaactatcccctgggcaatgtgcatctcttggga
tacagccttggggcccatgctgctggtattgcaggaagtttgaccaataagaaggtcaac
aggattaccggcctagatccagctggacctaactttgagtatgcagaagctccaagtcgc
ctttctcctgatgatgcggattttgtagacgttttacacacattcaccagggggtcacct
ggccgaagtatcggaatccagaaaccagtagggcatgttgacatttaccctaacggaggc
actttccaaccaggatgtaacattggggaagctctccgtgtgattgcagagagaggcctt
ggagatgtggaccagctagtgaagtgctcccacgagcgttccgttcatctcttcattgac
tctctgttgaatgaagaaaatccaagtaaggcctaccggtgcaattctaaagaagccttt
gagaaaggtctctgcctgagctgcagaaagaaccgttgcaacaacatgggctatgagatc
aacaaggtcagagccaaaagaagcagcaagatgtacctgaagactcgttctcagatgcct
tacaaagtcttccattaccaagtaaagatacatttttctggaactgagagtaatacatac
accaaccaggccttcgagatctctctgtatggcactgtggctgagagcgagaacatccct
tttaccctgcctgaagtttccacaaataagacatactcctttctactttacacggaggtg
gatattggagaactgctaatgttgaaactcaaatggattagcgattcctacttcagctgg
tccgactggtggagcagccccggctttgatattgggaagatcagagtaaaggcaggagag
actcagaaaaaggtgatcttctgttcccgggagaaaatgtcttatctgcagaaaggaaag
tcacctgtgatatttgtgaaatgccatgacaagtctctgaatagaaagtctggctggtga

DBGET integrated database retrieval system