KEGG   Pantholops hodgsonii (chiru): 102341793Help
Entry
102341793         CDS       T02909                                 

Gene name
TGM6
Definition
transglutaminase 6
Orthology
K05624  
transglutaminase 6 [EC:2.3.2.13]
Organism
phd  Pantholops hodgsonii (chiru)
Brite
Enzymes [BR:phd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102341793 (TGM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 713 aa AA seqDB search
MTGRLQLLEGLRVTEVDWQRLSNGTAHHTQEYPGPELVVRRGQRFTFTLELSRPLESEET
LIFTVETGPQASEALRTKTVFQTSELERGDTWMAVKEAQTENTTTFSLASPPNAIIGRYQ
LSARVSSRRKYSDRKLGEFVLLFNPWCPEDDVFLDSEEERQEYVLNDSGIIFRGVEKRIR
AQGWNFGQFEEDILNICLSILDRTPSYQDDPATDVSHRHDPIYITRAVSAMVNSNNDRGV
VQGQWQGKYGGGTSPLHWRGSVTILHKWFKGRFKPVKYGQCWVFAGVMCTVLRCLGIATR
VVSNFNSAHDTDRNLSVDKYVDSFGRTLEDLTEDSMWNFHVWNESWFARRDLGPSYNGWQ
VLDATPQEESEGVFRCGPASVTAIREGDVHLAHDGPFVFAEVNADYITWLWNEDKSRERV
YSDTKKIGRCISTKAVGSDSRVDITSLYKYPEGSRKERQVYSKAVKKLFSVEASARRARV
RRGGSRRLWCDDLLEPATKPSITGKFKVLEPPVLGHDLKLALCLTSLTSRAQRVQVNLSG
ATILYTRRPVAEILHESHTVKLGPEEEKKIPIAISYSQYKEGLTEDKKILLAAMCLVTKG
EKLLVEKDITLEDFITIKVLGPAMVGVAVTVEVMVLNPLSERVEDCMLMVEGSGLLQGQL
SIDVPSLEPQEKASVQFKITPFKSGPRQLQVDFVSPHFPDIKGFVIIHVATAK
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcagactgcagctgttggaagggctcagagtcactgaggtggactggcagcgg
ctgagcaacggcactgcacaccatacccaggagtaccccggccctgagctggtggtccgc
aggggccagaggttcaccttcacactggagctgagcagacccctggagagcgaggagacc
ctcatcttcaccgtggagacaggaccccaggcttctgaggccctccgcaccaaaaccgtg
ttccagacgtcagagctggagcggggtgacacctggatggcagtgaaggaggctcagaca
gagaacaccacgaccttcagccttgccagccctccaaatgccatcattggccgttaccag
ctgagtgccagggtatcttctcgccgcaaatatagtgaccggaagctgggcgagtttgtt
ctccttttcaacccatggtgcccagaggacgatgtgttcctggactcagaggaagagaga
caagagtatgtgctcaacgacagcgggatcatcttccggggtgtggagaagcgcatccga
gcccaaggctggaacttcgggcagtttgaggaggacatcctgaacatctgcctctccatc
ctggaccgaacccctagttaccaagacgacccagccaccgacgtgtcccaccgccatgac
cccatctacatcaccagagctgtcagtgccatggtgaacagcaacaacgaccggggtgtg
gtacaaggccagtggcagggcaagtacggcggcggcaccagccctctgcactggcgtggc
agcgtgaccattctgcacaagtggttcaagggcaggttcaagccagtcaaatacggccag
tgctgggtctttgctggagtcatgtgcacagtcctcaggtgtttgggaatcgcgacacgg
gttgtgtccaactttaactcagcccatgacacggacaggaacctgagtgtggacaagtac
gtggactccttcgggcgaacgctggaagacctgacggaagacagcatgtggaacttccat
gtctggaatgagagctggtttgcccggcgggacctgggcccctcttacaatggttggcag
gttctggatgccaccccccaagaggagagcgaaggcgtgttccggtgtggcccagcctcg
gtcaccgccatccgcgagggcgacgtgcatctggcccatgatggtcctttcgtgtttgcg
gaggtcaacgcagactacatcacctggctctggaatgaggataagagccgggagcgtgtg
tactcagacacgaagaagatcgggcggtgcatcagcaccaaggcggtgggcagcgactcc
cgcgtggacatcaccagcctttacaagtatccggaagggtcccggaaggagaggcaggtg
tacagcaaggccgtgaagaagctgttcagtgtggaagcctctgcaaggagggcccgggtc
cgcagagggggcagccgtagactctggtgtgatgacctcctggagcctgccaccaagccc
agcatcactggcaagttcaaggtgctggagccacccgtgctgggccatgacctgaagctg
gccctgtgcttgaccagcctcacctcccgggcccagcgggtccaagtcaacttgagcggt
gccaccatcctttacacccgcaggccagtggcagagatcctgcatgaatcccacacagtg
aagctagggccagaagaagagaaaaagatcccaattgcaatatcttattctcaatacaag
gagggcctgacagaggacaagaagatcctcttggctgccatgtgccttgtgaccaaagga
gagaagctcctggtggagaaggacattactctggaggacttcattaccatcaaggtgctt
ggcccagccatggtgggggtggcagtcacagtagaagtgatggtgcttaaccctctctcg
gagagagtggaagactgcatgctaatggtggagggcagtggccttctccagggacagctc
agcatcgatgtgcccagcctggagccccaagagaaggcctcggtccaattcaagatcact
cctttcaagagcggcccacggcagctgcaggtagacttcgtcagcccccacttcccggac
atcaagggctttgtgattatccacgtggccacagctaaatga

DBGET integrated database retrieval system