KEGG   Pantholops hodgsonii (chiru): 102342098Help
Entry
102342098         CDS       T02909                                 

Definition
ecto-ADP-ribosyltransferase 5-like
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
phd  Pantholops hodgsonii (chiru)
Brite
Enzymes [BR:phd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102342098
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 314 aa AA seqDB search
MIQATLLISLSCLSVYTLGSGVRRYDPGQGVTIQYLSLAPDTFDDAYVGCSEEMEEKAVL
LLEKEMANYTRLRESWETAQKAWEQKHPGLILPPGFRSQHGIAIMVYTNSSNTLYRELNQ
AVRTGGGGWGGGHFPFKALHFYLTRALQLLRGGGGCSREPGQMVFRGVRRIHFEPKSVGD
SIRLGQFASSSLDETVARGFGNATFFSLRTCSGAPIQALSVFPEEREVLIPPYEVFVVTN
FSKDGNKSLVTLSSSDQMCSHFNCAYLGEKKRPSCESVPIGGQGDSLSKRAFSLLSWKTL
LLASWGFQLLGAGL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgatacaggcaactctgctgataagcctcagctgcctcagcgtctacaccctcggcagt
ggtgtccgccgttatgaccctgggcagggtgttaccatccagtacttgagcctggctcca
gacacattcgatgatgcctatgtgggctgctcggaggagatggaggagaaagcagtgctt
ctgttagagaaggagatggccaactatactcggttgcgggagtcctgggagacagcccag
aaggcctgggagcaaaaacatccagggctcattctgcctcctggcttcagaagccagcac
ggaatcgccatcatggtctacaccaactcatccaacactttgtaccgggagctgaaccag
gctgtgcggactggcggggggggctgggggggggggcacttccctttcaaggccctgcat
ttctacctgacccgggccctgcagctgctgcggggtggtgggggctgcagcagggaacct
gggcagatggtgtttcgtggcgtgcgcaggattcactttgaacccaagagtgtgggggac
tctatccgcttgggccagtttgcctccagctcgctggatgagacagtggcccgtggattt
ggtaatgccactttcttctctctaaggacttgctctggagcccccatccaggccctgtct
gtctttcctgaggaacgtgaggtgctgatccccccatatgaagtctttgtggtgacgaat
ttctctaaggatggaaacaaaagcctggtgactctctccagcagtgatcagatgtgcagc
cactttaactgcgcctatctgggtgagaagaagaggccgagctgtgagtctgtgccaatt
ggagggcagggagactcactctccaagagggccttctctctgctctcctggaagacactg
ctcttggcctcttgggggttccagctcttaggagctgggctctga

DBGET integrated database retrieval system