KEGG   Pantholops hodgsonii (chiru): 102342880Help
Entry
102342880         CDS       T02909                                 

Gene name
PPOX
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    102342880 (PPOX)
Enzymes [BR:phd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     102342880 (PPOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 477 aa AA seqDB search
MGRTVVVLGGGISGLAASYYLSRAPCPPKVVLVEGSERLGGWIRSVRGPDGAIFELGPRG
IRPAGALGARTLLLISELGLDSEVLPVRGDHPAAQNRFLYVGGALHALPSGIRGLLRPSP
PFSKPLFWAGLRDLTTPRGKDPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSI
RSCFPSLFQAEQTHRSILLGLLLGAGRGPQLDSALIRQARAERWSQWSLRGGLETLPQAL
NAHLTSRGVSVLQGQPVCGLSLQAEGRWKVSLEDSSLEADHIISAIPASVLSKLLPAEAA
PLARALSTITAVSVAVVNLQYRGARLPVQGFGHLVPSSEDPVILGIVYDSVAFPEQDGSP
PGLRLTVMLGGSWLQTLEARGCVLSQELLQREAEKAAATQLGLNEPPSHCLVHLHKNSIP
QYTLGHWQKLESAAQFLAAQKLPLTLAGASYEGVAVNDCIESGRQAAARVLGTEPNS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaccgtggtcgtgctgggcggagggatcagtggcttggccgccagttactac
ctgagccgggccccctgtccccccaaggtggtcttggtggagggcagcgagcgcctggga
ggctggatccgctcagtacgcgggccagatggtgctatttttgaacttggacctcgagga
attcggccggcaggagccctgggagcccggaccctgctcctgatttctgagcttggcttg
gactcagaagtgttgcctgtccggggagaccatccagctgcccagaacaggttcctgtat
gtaggtggtgctctgcatgccttgccctctggcatcagggggctcctccgcccttcacct
cccttctccaaacctctgttctgggctgggctgagggatttgaccacccctcgtggcaaa
gaccctgatgagactgtgcacagttttgcccagcgccgccttggtcctgaggtggcgtct
ctagccatggacagtctctgccgtggagtgtttgcaggcaacagccgtgagctcagcatc
aggtcctgctttcccagtctcttccaagctgagcaaacccaccgttccatattactgggg
ctgctgctgggggcaggccggggcccacagctggactcagcgcttattcgccaagctcgg
gctgagcgctggagccagtggtcactccgtggagggctggagacattgccccaggccctc
aacgcccacctgactagtagaggtgtcagtgttctccaaggccagccagtctgtgggctc
agtctccaggcagaagggcgttggaaggtgtctctagaggacagcagcctggaggctgac
cacattattagtgctattccagcttcagtgctcagcaagctgctccctgctgaggctgca
cctctggcccgtgccctgagcaccatcactgctgtgtctgtggctgtggtgaatctgcag
taccgaggagctcgtctgcctgtccagggatttggacatttggtgccttcctcagaagat
ccagttatcctgggaattgtgtatgactccgttgctttccctgagcaggatgggagcccg
cctggcctcagactgactgtgatgctgggaggttcctggttacagacactagaagccagg
ggctgtgtcttatctcaggagctgctccaacgggaggcagagaaagctgctgccactcag
ttaggattgaatgagccaccaagtcactgcttggtccatctacacaagaactctatcccc
cagtatacattaggccactggcaaaaattggagtcagctgcccaattcctggctgctcag
aagctgcctttgactctggccggggcctcctatgagggggttgctgtcaatgattgtata
gagagtgggcgtcaggcagcagcccgtgtcttaggcacagaacctaacagttga

DBGET integrated database retrieval system