KEGG   Pantholops hodgsonii (chiru): 102344135Help
Entry
102344135         CDS       T02909                                 

Gene name
ART4
Definition
ADP-ribosyltransferase 4
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
phd  Pantholops hodgsonii (chiru)
Brite
Enzymes [BR:phd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102344135 (ART4)
Cellular antigens [BR:phd04090]
 Proteins
  102344135 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 323 aa AA seqDB search
MELRGQRSALHANKCCPLTSHCRRILLANTAASAVRIWLLRGQLLLLLLCSGLQRPTIAV
KIDFDLAPNSFDDQYRGCSQQVMEMLLQGDYFMEELESSKHYRKVWQQTHLNWLNQEKTL
PRNMTITHAVAISVYLSDDRVHLDFSRAMASAAGSPQQYKHSFRFKYLHYFLTSAIQLLR
KEIVSRKDSLCYEVQHELKGVYLQAPMGAIVRFGQFLSTSPATEQAQRFGNQTLFTMLTC
LGAPVQDFSLKKEVLVPPYELFKVVNASYHPRGNWLQLLSNGNQSTYNCQLLKASSRKCI
PTPLVIASLSFLTSVVIFSKSEA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggagctgcgagggcaaagaagtgctctgcacgcaaacaaatgctgtcccttgaccagt
cattgcagaaggattcttctagcaaatactgcagcctctgcagtaagaatctggctcctg
agggggcagcttcttctcctgctgctgtgctctggtctgcagagacccacgattgcagtt
aaaatcgactttgacttggcaccaaattcctttgatgatcagtaccgaggctgcagccaa
caagtcatggagatgctgcttcaaggggattatttcatggaagaactagaatccagtaag
cattaccgcaaagtctggcagcaaacacacttaaactggttgaaccaagaaaaaactctc
cccaggaacatgactattacacatgctgtggctatctcggtttatctatcggacgacaga
gttcacttagacttctccagagccatggccagtgctgctgggtctccgcagcagtataaa
cattcattccgcttcaaatatctgcactacttcctgacctcagcaatccagttgctgagg
aaagagattgtctcaaggaaagactctctgtgttacgaggtgcagcatgagttgaagggc
gtttacttgcaagctcccatgggtgccatcgttcgctttggccaattcctctccacctcc
ccagcaacagaacaggcacagaggtttgggaaccaaactctatttaccatgttgacctgc
ctgggggcaccagtacaagacttctctctcaagaaggaggtcttggtccctccctatgag
ctgtttaaagtggtcaatgcgagctaccatccaagaggaaattggttgcaattgctgtca
aatgggaaccaaagcacgtacaactgtcagctgctaaaagcttccagcagaaagtgcatc
cctactcctctagttattgcttctctctcctttttgaccagtgtcgtcatcttttccaaa
agtgaagcataa

DBGET integrated database retrieval system