KEGG   Pedobacter heparinus: Phep_0033Help
Entry
Phep_0033         CDS       T00978                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
phe  Pedobacter heparinus
Pathway
phe00010  Glycolysis / Gluconeogenesis
phe00030  Pentose phosphate pathway
phe00051  Fructose and mannose metabolism
phe00052  Galactose metabolism
phe00680  Methane metabolism
phe01100  Metabolic pathways
phe01110  Biosynthesis of secondary metabolites
phe01120  Microbial metabolism in diverse environments
phe01130  Biosynthesis of antibiotics
phe01200  Carbon metabolism
phe01230  Biosynthesis of amino acids
phe03018  RNA degradation
Module
phe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Phep_0033
   00030 Pentose phosphate pathway
    Phep_0033
   00051 Fructose and mannose metabolism
    Phep_0033
   00052 Galactose metabolism
    Phep_0033
  Energy metabolism
   00680 Methane metabolism
    Phep_0033
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Phep_0033
Enzymes [BR:phe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Phep_0033
Protein phosphatases and associated proteins [BR:phe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Phep_0033
Messenger RNA biogenesis [BR:phe03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Phep_0033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Alba
Motif
Other DBs
NCBI-ProteinID: ACU02259
UniProt: C6XXK5
Position
37232..38215
Genome map
AA seq 327 aa AA seqDB search
MNKIKNIGVLTSGGDAPGMNAAIRAVVRAAIYYDLEVTGILRGYEGLVHGDFIEMNRKSV
ANIIQRGGTILKTARSETFKTAEGREMGYQQLKKHHIDALIVIGGDGTFTGANLFTNEFD
FPIVGLPGTIDNDLQGTDFTIGYDTAINTVVNAVDKIRDTAESHDRLFIVEVMGRDSGLI
ALRSGIGVGAEAILIPEANMGVEGLIQRLENGRKDKASKIVIVAEGDEVGGAFNVGEALK
QKFPNYDIRVSVLGHIQRGGKPSCMDRVLASRFGVAAVEGVLAGQSGVMVGQVNRELIFT
PFDHAIKHIDAQQVSPAWLKLVEILSL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagattaaaaatataggagtattaacttccggcggtgacgccccgggaatgaat
gctgccattagggcagttgttagagcggcaatttactatgatttggaagttacaggtatt
ttaaggggttatgaaggcttggttcatggcgattttatcgaaatgaacagaaaatcggta
gcgaatatcattcaacggggcggaactattttaaaaactgcccgtagtgaaacgttcaag
accgcggaaggtcgtgaaatgggataccagcaattaaaaaaacaccatatagatgccctg
atcgtgattggtggtgacgggacttttaccggggcaaatttatttacgaatgagtttgat
tttccgatagtgggccttccgggtaccatagataatgatttacagggaacagattttacg
attggatatgatacggccattaatacagtcgtaaatgcggttgacaaaataagggatact
gctgaatcgcatgacaggctgttcattgtagaggtgatgggccgggattcgggactgatt
gctttgagaagcggtataggagtgggcgctgaagcgatccttatcccggaagcgaacatg
ggtgtggaaggcctgatccagcgcctggagaacgggcgtaaagacaaggcctcaaaaatt
gtgatcgttgctgaaggtgatgaagttggcggggcttttaatgttggagaagcactcaaa
caaaaattcccgaactacgacatcagagtctcggtactgggacatatacagcgtggtggg
aaaccaagctgtatggaccgggttctggcaagcaggtttggcgtggccgccgttgagggg
gttttggccggacagtcgggcgtaatggttggacaggtaaaccgggagctcatttttacc
ccatttgatcatgccataaaacatattgatgcacagcaggttagtccggcctggttaaaa
ctagtagaaattttatctttataa

DBGET integrated database retrieval system