KEGG   Pedobacter heparinus: Phep_0033Help
Entry
Phep_0033         CDS       T00978                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
phe  Pedobacter heparinus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Phep_0033
   01230 Biosynthesis of amino acids
    Phep_0033
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Phep_0033
   00030 Pentose phosphate pathway
    Phep_0033
   00051 Fructose and mannose metabolism
    Phep_0033
   00052 Galactose metabolism
    Phep_0033
  Energy metabolism
   00680 Methane metabolism
    Phep_0033
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Phep_0033
Enzymes [BR:phe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Phep_0033
Protein phosphatases and associated proteins [BR:phe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Phep_0033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
37232..38215
Genome map
AA seq 327 aa AA seqDB search
MNKIKNIGVLTSGGDAPGMNAAIRAVVRAAIYYDLEVTGILRGYEGLVHGDFIEMNRKSV
ANIIQRGGTILKTARSETFKTAEGREMGYQQLKKHHIDALIVIGGDGTFTGANLFTNEFD
FPIVGLPGTIDNDLQGTDFTIGYDTAINTVVNAVDKIRDTAESHDRLFIVEVMGRDSGLI
ALRSGIGVGAEAILIPEANMGVEGLIQRLENGRKDKASKIVIVAEGDEVGGAFNVGEALK
QKFPNYDIRVSVLGHIQRGGKPSCMDRVLASRFGVAAVEGVLAGQSGVMVGQVNRELIFT
PFDHAIKHIDAQQVSPAWLKLVEILSL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagattaaaaatataggagtattaacttccggcggtgacgccccgggaatgaat
gctgccattagggcagttgttagagcggcaatttactatgatttggaagttacaggtatt
ttaaggggttatgaaggcttggttcatggcgattttatcgaaatgaacagaaaatcggta
gcgaatatcattcaacggggcggaactattttaaaaactgcccgtagtgaaacgttcaag
accgcggaaggtcgtgaaatgggataccagcaattaaaaaaacaccatatagatgccctg
atcgtgattggtggtgacgggacttttaccggggcaaatttatttacgaatgagtttgat
tttccgatagtgggccttccgggtaccatagataatgatttacagggaacagattttacg
attggatatgatacggccattaatacagtcgtaaatgcggttgacaaaataagggatact
gctgaatcgcatgacaggctgttcattgtagaggtgatgggccgggattcgggactgatt
gctttgagaagcggtataggagtgggcgctgaagcgatccttatcccggaagcgaacatg
ggtgtggaaggcctgatccagcgcctggagaacgggcgtaaagacaaggcctcaaaaatt
gtgatcgttgctgaaggtgatgaagttggcggggcttttaatgttggagaagcactcaaa
caaaaattcccgaactacgacatcagagtctcggtactgggacatatacagcgtggtggg
aaaccaagctgtatggaccgggttctggcaagcaggtttggcgtggccgccgttgagggg
gttttggccggacagtcgggcgtaatggttggacaggtaaaccgggagctcatttttacc
ccatttgatcatgccataaaacatattgatgcacagcaggttagtccggcctggttaaaa
ctagtagaaattttatctttataa

DBGET integrated database retrieval system