KEGG   Pedobacter heparinus: Phep_0172Help
Entry
Phep_0172         CDS       T00978                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
phe  Pedobacter heparinus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Phep_0172
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Phep_0172
   00020 Citrate cycle (TCA cycle)
    Phep_0172
   00620 Pyruvate metabolism
    Phep_0172
Enzymes [BR:phe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Phep_0172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
200882..202537
Genome map
AA seq 551 aa AA seqDB search
MAEIVRMPKMSDTMTEGVMAKWHKKVGDKVKSGDVMAEVETDKATMDLESYWDGTILYIG
VEEGKAVPVDAIIAVVGKEGEDYKAALAAEEGAAPVPAKEEKAAEPSSEKPAEDGSGTTA
GLSEAELTAKGVTVIRMPLLSDTMTEGVIAEWHKKVGDKVKDDDILADVETDKATMEVMG
YATGTLLHIGVEKGQAAKVNGIIAIVGPEGTDISGILSQGDAPAKPAADAKSDAPVAEKA
VAEVKEETPVASGSGERLKASPLAKRIAKDKGIDLAQVAGSADGGRIIKKDIENFKPAAA
PANTASSSAPAAEKAAPVIPQYVGEEKYTEKPVSQMRKVIAKRLAESLFTAPHFYLNISI
DMDNAISARTAINAVAPVKISFNDIVIKAVAVALKQHPAVNSSWGGDKIRFNEHTNIGVA
MAVEDGLLVPVVRFADGKSLSHISAEVKAYGQKAKAKKLQPSDWEGSTFTVSNLGMFGID
EFTSIINSPDGAILSVGAIQQVPVVKNGAVVPGNIMKLSLGCDHRVVDGATGAAFLQTLK
GLLEEPIRLLV
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatagttagaatgcccaaaatgagtgataccatgaccgaaggggtgatggct
aagtggcataaaaaagttggcgataaagtaaaaagcggtgatgtaatggccgaagtggaa
accgataaggctactatggatttagaatcatactgggatggtaccattttatacattggt
gtagaagagggaaaagctgttccggttgatgccattattgcagtagtaggtaaggaaggc
gaagattataaagctgcactggcagcagaagaaggtgctgctccagtaccagccaaagag
gagaaagctgctgagccatcatcagaaaaacctgctgaagatggttctggtacaacagct
gggttatcggaagctgagcttactgcaaaaggggttaccgttatccgcatgcctttatta
agtgataccatgactgaaggcgtgattgctgaatggcataaaaaagtaggtgataaagta
aaagacgatgatatccttgctgatgtagagaccgataaggccactatggaagtgatgggt
tatgctaccggaactttattgcatattggtgtagaaaaaggacaggctgccaaagtaaat
ggtattattgccattgttggcccggaaggaactgacattagtggaatcctgagccagggc
gatgcgcctgccaaacctgccgcagatgcaaaatctgatgcgcctgttgcagaaaaagct
gttgctgaagtaaaagaagagactcctgtagcctctggtagtggagaacgtttaaaagca
tcgccgctggctaaacggattgccaaagataaaggtattgatctggcccaggttgcaggt
agtgctgatggtggcaggatcattaaaaaagatatagaaaactttaaacctgcggcagcc
ccggcaaatacagcatcttcatcagctccggctgcagagaaagccgcaccggttattcct
caatatgtaggtgaagaaaaatatacagagaaaccagtctcgcaaatgcgtaaggtgatt
gccaaacgtttggcagaaagcctgtttactgcccctcatttttacctgaacatcagtatt
gatatggacaatgccatatcagcccgtactgcaatcaatgcggtggctcccgtgaagatt
tctttcaatgacattgtcattaaagcagttgccgttgcattgaaacaacatcctgccgtt
aactcttcatggggcggagataagatccgtttcaatgagcatacgaacattggtgtggcc
atggctgtagaagatggtttactggttcctgtagttcgttttgctgatggcaaatcgttg
tctcatatctctgctgaggttaaggcatatgggcagaaagcaaaagctaaaaaactacaa
ccgtcagactgggaaggttctacctttaccgtttctaacctgggtatgtttggtattgat
gaatttacatcaatcattaactctccggatggtgcgatcctatctgtaggtgctatacag
caggtacctgtggttaaaaacggagcggttgttcctggtaacatcatgaagctaagttta
ggctgcgatcaccgtgtggttgatggggctacaggtgccgcgttcctgcaaacgcttaaa
ggcttgctggaagagccaataagattattggtttaa

DBGET integrated database retrieval system