KEGG   Pedobacter heparinus: Phep_0679Help
Entry
Phep_0679         CDS       T00978                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
phe  Pedobacter heparinus
Pathway
phe00010  Glycolysis / Gluconeogenesis
phe00052  Galactose metabolism
phe00500  Starch and sucrose metabolism
phe00520  Amino sugar and nucleotide sugar metabolism
phe00521  Streptomycin biosynthesis
phe01100  Metabolic pathways
phe01110  Biosynthesis of secondary metabolites
phe01120  Microbial metabolism in diverse environments
phe01130  Biosynthesis of antibiotics
phe01200  Carbon metabolism
Module
phe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Phep_0679
   00052 Galactose metabolism
    Phep_0679
   00500 Starch and sucrose metabolism
    Phep_0679
   00520 Amino sugar and nucleotide sugar metabolism
    Phep_0679
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Phep_0679
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Phep_0679
Enzymes [BR:phe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Phep_0679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACU02901
UniProt: C6Y1C5
Position
789047..790024
Genome map
AA seq 325 aa AA seqDB search
MRLLAIDLGGTKLALATFTADGNVTSKDTVLLSGRQGKQVGKLIVDLVADQIALADRQAD
EIAAIAVSIPGISNVKNSTVWAPNISGWEAYPLLQEIETVSGQIPVTIESDRSCYILGEV
WQGAAKGCKDAIYLSVGTGIGAGIMAGGQILRGANDIAGAIGWLALRPPYHEKYKNHGHF
EYYTSGEGIVRLTRELLHTKPAYKGGLRMKDPGELTTQKVFAAFMAEDEIAIQVFKHCIE
YWGMAVANLVSLFNPEKIIIGGGVFGPASAFIPAIYEEAKRWGQPISAGLFVLEGSALGA
DAGIYGAGYAALKTFREFNAKNNVQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgagattattagcaattgatcttggaggaacaaaattagccctggctacatttacagca
gatggcaatgtgaccagtaaggatactgtacttttaagtgggagacaaggtaaacaggtt
ggaaagctgattgtagatctggttgctgaccagattgctcttgccgaccggcaggctgat
gaaattgcagctattgcggtttccattccaggtatcagtaatgttaaaaacagcacggtt
tgggcaccgaacatctccggatgggaagcttatccgcttttacaggaaatcgagaccgtt
agcggacagattcctgtaactattgagagcgacaggagctgttatattttaggagaggta
tggcagggggctgcaaaaggctgcaaggatgctatttatttgtcggtaggcaccgggata
ggcgcaggaataatggcaggcggccaaattttgcgcggtgcaaatgacattgccggtgcc
ataggctggctggctttgaggcctccttatcatgaaaaatataaaaaccacgggcatttt
gaatattatacttccggagaaggtattgtaaggctgacaagggagctgcttcatacaaag
ccagcgtataaaggaggcttacgcatgaaggatcctggcgaacttactacacaaaaggtg
tttgccgcttttatggcagaagacgaaatcgcaatccaggtttttaaacattgtattgaa
tactggggaatggcagtagccaatctggtcagtctgttcaatccggaaaagatcattata
ggcggcggggtatttggcccggcaagcgcttttatacctgctatttatgaagaggcaaaa
agatggggccagcctataagtgccggtttgtttgtcttggaagggtcggcattaggagca
gatgcaggtatatacggtgcaggttatgctgccttaaaaactttcagggaatttaacgcc
aaaaacaatgttcaataa

DBGET integrated database retrieval system