KEGG   Pedobacter heparinus: Phep_1157Help
Entry
Phep_1157         CDS       T00978                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
phe  Pedobacter heparinus
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Phep_1157
   00500 Starch and sucrose metabolism
    Phep_1157
Enzymes [BR:phe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Phep_1157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1358998..1359966
Genome map
AA seq 322 aa AA seqDB search
MAKLGLKCLTIALVALLSGTNIYGQDKKIIVAQDGSGDYKTVQEAINAVPDFRNATTVIL
IKNGNYKEKLNLSASKKMVKLIGENPEKTVLTYDDYAQKKNSFGEAMGTSGSSSFYIYGD
GFAAENITFANSSGPVGQAVAVWIASDQAVFKNCRFLGFQDTLYTYGRGSRQYYKNCYIE
GTTDFIFGSSTAMFENCILFCKKGGSYLTAASTPDTTKYGYVFKNCKITGDAPENSFALG
RPWRPYAKTVFINCELGNMIKPAGWDHWGKESNKQTAYYAEYKNTGPGYKPDKRTDWSQQ
LSDDEAKTYNITQVFRGWNPVQ
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattgggtcttaaatgccttactatagccctggtagccctgctatcgggaacg
aatatttacggccaggataaaaagatcattgttgcacaggatggtagtggtgattataaa
acggtacaggaagctataaacgcggtgcccgattttagaaatgccactacggttatcctg
atcaaaaatggcaattacaaagaaaaacttaacctttcggcctctaaaaagatggttaaa
ctgattggcgaaaaccctgaaaaaactgtgcttacttatgatgactatgcacaaaagaaa
aacagtttcggagaagcaatgggtacttcaggatcttcctcattctatatttatggggat
ggttttgctgcagagaacatcacctttgccaattcttcagggccggtcggacaggctgtt
gcggtatggatcgcatcggatcaggcggtattcaaaaactgcaggttccttggttttcag
gatacactttatacctatggccgtggcagcaggcaatattataaaaactgttatatagaa
gggacaactgattttatttttgggtcatctactgcaatgtttgaaaattgtatcctcttt
tgcaaaaaaggtgggtcataccttaccgcggcctctacccccgatacaaccaaatatggt
tatgttttcaaaaattgtaaaataaccggcgatgcacctgaaaactcttttgcattgggc
cgtccatggcgaccgtatgctaaaactgttttcatcaattgcgaacttggaaatatgatc
aaacccgccggctgggaccattggggtaaagagagcaataaacagacagcctattatgca
gaatataaaaacaccggacctggttataaacccgataaaagaacagattggtcgcagcag
cttagtgatgacgaagccaaaacttataatataacacaggttttccgtggctggaaccct
gtacaataa

DBGET integrated database retrieval system